KEGG   Plasmodium vivax: PVX_099570Help
Entry
PVX_099570        CDS       T01073                                 

Definition
NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pvx  Plasmodium vivax
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 746 aa AA seqDB search
MNPRASRLLLQGSLFCACAVFLAWKGRHSPLLGKVTNILRRILGLKSERSIEENDQIRDN
VKIYFGSQGGTAEQFSKELSTNLRDIFKIKAEVIDLEYFKKEEISKFGVRIFIVATYGDG
EPTDNACAFFKWLKSLSDDNGYFRNTLYSIMGLGSKQYKHFNKVAKKLANYLAKFKARQI
SENVFGDDDDNIYQDFEIWKKKFFKELVKLLHLKEDIIPVHIVAENAVELVDWTALPEVN
LGIQYGEEVVAVGGAANGEAAKGEAADGAVGGAPPGENEPTILPHQTTDITGKFFFNHHR
GRVISNENLLKNVNDSADDDKVNRIVIAVEKVSFKAADTFVVLAKNPRRVTSWWLKRLGL
DDTDGKKRFTFVPRNVMEKPPTGSPQSSSNLNALPSSRPQDPPPVCVPFPTPCSVEDALA
YYCDLTTIPRVNILKKFKCFIKDVEERKMFNHILSNKQRSTFFNICKEADMTFIEFVDIF
MAKAEFELTPFLQLIPRNVPKSYTISSSPKEAEDTISLTVKKKQYPIHSLRKALKGFKSN
DMLPPISEQKLRELCSRRWFKGASSFYLTEELSPNDSVKFNLKSSKFCFPPYLESTNIIM
IATGTGIAPFKAFITEFKHFDQMCVQNGIAKRAKRILFFGCRKREIDFLYEREIADAEQG
KHIDQVFLAFSRDQHEKVYVQDLILERKDLVWSLIQKGAYVYVCGNSNMSRDVNKTINSL
PMHYKQNNKKFTKKLKKEGRYVEEMW
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcgggcgagcaggctcctcctgcaggggtcgctcttctgcgcctgcgcggtg
ttcctcgcctggaagggcaggcactcccccctcttgggaaaagtgacaaacattttaaga
agaatcctcggcttgaagagtgaaagatccattgaggaaaacgaccaaattagggacaac
gtgaagatatactttggcagccaaggaggaacggcggagcagttttccaaagaactgagc
acaaatctaagggacattttcaaaataaaagcagaggtaatcgatttggaatatttcaaa
aaggaagagatatcaaaatttggggtgcggatattcatcgtggcgacttatggagatgga
gagcctacagacaatgcatgtgccttttttaagtggctcaaaagtctgagcgatgacaat
gggtattttaggaacaccttatattccatcatgggattaggaagcaaacagtataagcac
tttaacaaagttgcgaaaaagctagccaattatctagccaaatttaaggcaagacagatt
agcgaaaatgtatttggggatgatgatgacaatatatatcaggactttgaaatttggaaa
aagaaattttttaaggaactggtcaaactgctccatttgaaggaggacatcattccggtg
cacattgtcgcggaaaatgcggtcgagttggtggactggacggcccttccggaggtaaat
ctgggcattcagtacggggaagaagtagtagcggtgggaggggccgctaacggggaggcc
gctaagggagaggccgctgacggagcggtgggaggggccccccccggtgaaaacgagcca
acgattttgccccaccaaacgacggacataacgggcaagttcttcttcaaccaccacagg
ggaagggtcatatcgaatgagaacctcctgaaaaatgtgaacgacagtgctgacgatgat
aaggtcaatcgtatagtcatcgccgtggagaaggtctccttcaaagcagctgacacgttt
gttgtgttagcgaaaaacccgaggcgagtcacctcctggtggttgaagcggttaggctta
gacgatacagacgggaaaaagagattcacctttgtgcctaggaacgtaatggagaagccc
cccacaggatctccccagagtagttccaatttgaatgccttaccaagcagtcgtccgcag
gaccccccccctgtgtgtgtccccttccccacgccatgcagcgtggaagacgccctggca
tactactgcgacttgacgaccataccgagggtgaacatcttgaagaagttcaagtgcttc
attaaagatgtggaggaacgcaaaatgtttaatcatatcctttccaataagcagagaagt
acctttttcaacatttgcaaagaggcagatatgaccttcatcgaatttgtagacatattc
atggctaaagctgagttcgagttaaccccatttttgcaactaattccgaggaatgttccc
aaaagttacaccatttcttcatcccctaaggaagcggaagacaccatctctttaaccgtt
aagaagaaacagtaccctattcattctcttagaaaggctctgaaagggtttaaaagtaac
gatatgcttccccccataagtgagcagaagttacgagaactttgcagcaggcgatggttt
aaaggtgcatcctccttctacctaacggaggaattatccccaaatgatagcgtaaaattt
aatttgaaatcttccaaattttgttttcccccctatttggagtcgaccaacattatcatg
atcgccactgggacgggaattgcccccttcaaagcgttcataacggaatttaagcatttc
gaccaaatgtgtgtgcagaatggaatagccaagagggccaagcgaatcctcttcttcgga
tgcagaaagagagaaatagacttcctctacgaaagggaaattgcggatgctgagcaaggg
aagcatatcgatcaagtgtttctcgctttctcaagagatcaacatgaaaaggtttatgtg
caggatttaattctggagaggaaggaccttgtctggagtttgattcaaaagggggcctac
gtctacgtttgtggcaacagcaacatgagcagggatgtgaacaaaacgattaacagcttg
cccatgcattacaaacaaaacaataagaaatttaccaaaaagttgaagaaggagggccgc
tatgtggaagaaatgtggtga

DBGET integrated database retrieval system