KEGG   Rickettsia africae: RAF_ORF0031Help
Entry
RAF_ORF0031       CDS       T00979                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
raf  Rickettsia africae
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RAF_ORF0031 (folA)
   00670 One carbon pool by folate
    RAF_ORF0031 (folA)
Enzymes [BR:raf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RAF_ORF0031 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34147..34641)
Genome map
AA seq 164 aa AA seqDB search
MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIVMGRKTFDSIPTKILK
NCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVGGTEIATLFLEQNLIDE
FLLTKINKNYDGDTFLPLNLLAEWHSVIIDKTNNYQIYKFTKRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaaaaatcatcggtataatggcatgtgacccacaaggggtgataggtaat
aaaggtcagatgccttggtcttatactaaggagtttgaatatttttatcagacggtaaaa
aataatattatagtcatgggacgaaaaacctttgactctatacctacaaagattttaaaa
aattgtatttgtattgttttttcaagaaatacaccattacaatcttataataatatattt
tttattaaatccttagatgatttttggcaggtaataaaaccttttactgataaaaaaatt
tttatggttggagggacagaaatagcaactcttttcctagaacaaaatcttattgatgaa
tttttacttacaaaaataaataaaaattatgatggagatacttttttgcctcttaatctt
ttagcagaatggcattctgtaataatagataaaacaaacaattatcagatttataaattt
actaagaggaggtaa

DBGET integrated database retrieval system