KEGG   Rahnella sp. Y9602: Rahaq_2736Help
Entry
Rahaq_2736        CDS       T01422                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00860  Porphyrin and chlorophyll metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
Module
rah_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rahaq_2736
Enzymes [BR:rah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rahaq_2736
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rahaq_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADW74339
JGI: Rahaq_2736
UniProt: A0A0H3FBW4
Position
complement(2974123..2975097)
Genome map
AA seq 324 aa AA seqDB search
MSNQFPSSRLRRLRQSESLRTLFQETEFSVNDLVLPIFVEEETSEYVPIEAMPGVLRIPE
SRLAFEIERYARAGIRSVMTFGISHHMDATGSDTWNENGLVARMARICKDTVPEMIVMSD
TCFCEYTSHGHCGVLHDHGVDNDATLVNLGKQAVVAAAAGADFIAPSAAQDGQVQAIRSA
LDEAGFIDTSIMAYSTKFASSLYGPFREAGGSVLKGNRKQYQMNPMNRREAVRESLLDEQ
EGADALMVKPAGAYLDVIRDIREASRLPLAAYQVSGEYAMIKFAAQAGAIDERAVVRESL
GAIKRAGADIILTYFAMDIAENGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcagttcccgagctcacgccttcgccgcctgagacagtccgaatccctgcgc
actctttttcaggaaactgaatttagcgtcaacgatctggtactgccgattttcgtagaa
gaagagacctctgaatacgtacccatcgaagctatgccgggtgtgttgcgcatccctgaa
tcccgcctggcatttgaaatcgaacgttacgcccgcgccggtatccgctctgttatgacg
ttcggtatttcgcatcacatggatgctaccggcagcgatacctggaacgaaaacggtctg
gtcgcgcgtatggcgcgtatctgtaaagacaccgtgcctgaaatgattgtcatgtccgac
acctgtttctgcgaatacacctcacacggccattgcggtgtgttgcacgaccatggcgtg
gataacgacgcaaccctggtcaacctcggtaaacaggctgtcgtggcggcggctgctggt
gcagatttcatcgcgccatccgccgcgcaggacggtcaggtgcaggccatccgcagtgcg
ctggatgaagccggatttatcgatacctcaatcatggcgtattccaccaagtttgcatct
tccctgtacgggcctttccgcgaagcgggcggcagtgtactgaaaggcaaccgcaagcaa
tatcagatgaacccgatgaaccgccgcgaagccgtgcgtgaatcgttgctggacgagcag
gaaggcgccgatgcgctgatggtgaaaccggccggtgcgtatctggacgtgatccgcgat
atccgcgaagcctcccgtctgccactggcggcgtatcaggtcagcggtgaatacgcgatg
atcaaatttgctgcacaagccggtgctattgatgagcgtgccgtcgtacgtgaaagcctg
ggcgcgattaaacgtgctggcgcagatattatcctgacttacttcgcgatggatattgcc
gaaaacgggctgtaa

DBGET integrated database retrieval system