KEGG   Ruminococcus albus: Rumal_1744Help
Entry
Rumal_1744        CDS       T01387                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ral  Ruminococcus albus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rumal_1744
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rumal_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2000796..2001695
Genome map
AA seq 299 aa AA seqDB search
MALYNNIKVKAYGKINLLLDIIGRREDGYHMLNTVMQTVSVYDTLELSIDADSPEGIEIV
CDKEGFPLDSSNLIWKAAELFKEYTGITFGGKLIVKVEKNLPSQAGMGGGSADCAAMLKA
MNTFFCTLKDEDELCELGAKLGADVPFCIKGGTRLCQGIGEITNKLPSIDCAFVIVKPDV
SVSTPEAYKRYDLMKSPPRSHLDYFLKSLASGNVFSTIIYLFNVFEAAIDQPEIAQAKQT
LKEAGALNTLMTGSGSAVFGVFENEKYAEQAAAKLSGKYNYCEVCVPVKSGYELMWVNR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtataataatatcaaagtcaaggcatacggcaaaataaaccttttgctggat
ataataggaaggcgtgaagacggatatcatatgcttaataccgtcatgcagacggtaagt
gtgtatgatacgcttgaactttcgatagacgctgattctccggaaggtatagagattgtt
tgcgacaaggagggattcccccttgacagcagtaatcttatctggaaggcagctgagtta
ttcaaagagtatacgggtatcactttcggcggaaaacttatagtcaaagttgagaaaaat
ctgccgtctcaggcaggtatgggcggcggcagcgccgattgcgcggccatgctgaaagct
atgaatacattcttctgtacactgaaagatgaggatgaactctgtgaacttggtgcaaag
cttggtgcagatgttccgttttgtataaagggcggtacaaggctatgtcagggtataggt
gagataacaaataagctgccatccatagactgtgcttttgttatagtcaagccggatgtc
agtgtttccacacctgaggcttataagcgttatgatcttatgaaatctcctccgaggagc
catctcgattatttccttaaatcgcttgcttccggtaatgttttctccactatcatatac
ctcttcaatgtttttgaagcagccatagaccagccggagatagcacaggctaaacagacc
ctaaaagaggcaggtgccctcaatacacttatgacaggcagtggttcagctgtattcggt
gtttttgaaaatgaaaaatatgctgaacaagctgctgcaaaactttcaggcaagtataat
tactgtgaggtatgtgttcccgtaaagagtggatatgagcttatgtgggtcaacagatag

DBGET integrated database retrieval system