KEGG   Ruminococcus albus: Rumal_1794Help
Entry
Rumal_1794        CDS       T01387                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00030  Pentose phosphate pathway
ral00051  Fructose and mannose metabolism
ral00680  Methane metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
ral01200  Carbon metabolism
Module
ral_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_1794
   00030 Pentose phosphate pathway
    Rumal_1794
   00051 Fructose and mannose metabolism
    Rumal_1794
  Energy metabolism
   00680 Methane metabolism
    Rumal_1794
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Rumal_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 RE_HaeII Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ADU22292
JGI: Rumal_1794
UniProt: E6UA70
Position
2052793..2054742
Genome map
AA seq 649 aa AA seqDB search
MDKKYLQLLSKEFPNIDSAASEIVDLSAIRCLPKGTEYFFSDMHGEYEAFLHMLKSASGM
IKIKIDLTLGKTVSSAEREALAALIYYPDKEQKRLKKAGILTDEWRRLTIYRLILVLESV
SAKYTRSRVRKSIPHDMVYILDELLNVTDDVIKDYYYDEIITTILDTGIADHFIKEVCKV
IQSLAIDSLHIIGDIYDRGPRADIIMDELIKMHDVDIQWGNHDISWMGAASGNRALIANV
IRISMRYNNFDILEDGYGLNLRALAVFAGDVYKDDPCTIFMPHTLDDNIYDPVDTLLVAK
MHKAITVIQLKLESQLIKRHPEWGMDDRDLFSNLHPENGTVELKGKTYELLDKNFPTVNK
DDPLALTDEENELMTVLANSFMHSEKLAEHMRFLYTNGSMYKTINGNLLFHGCIPLDENG
ELLSVKIEGEDHSGKELLDKLDEVANKAYFLHSGEEKENSADLLWYLWCGPRSPLYGKDK
MAFFERYFIDDPSLHTENYNAYYQFSENADVCMRILEMFGLDPEKGHIINGHVPVKIKNG
ESPVKAGGKLFVIDGGISKAYQKATGIAGYTLICDSHSLNLAEHKPFIPGESEHTPTLHL
VERFEHRANICDTDRGEELLGKINDLRELLKAYRSGIIKQKKEIDRRTC
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggataagaaatacttacagctactgtcaaaagagttcccgaatattgacagtgccgcc
agcgagatagttgatctttccgctatccgttgtcttccgaaaggtacagaatattttttc
agtgatatgcatggtgagtatgaagcatttctgcatatgcttaaaagtgcatcgggaatg
ataaagataaagatcgacctaactttgggaaaaacggtttcttctgctgagagagaagcg
cttgctgcactgatctactatcccgacaaagaacagaagcgtcttaaaaaagcgggtata
cttaccgatgaatggcgaaggctcactatttatcgccttattcttgtccttgaatcggta
tctgcaaagtataccaggtctcgtgtcagaaaaagcattcctcatgatatggtatatatc
cttgatgaattgcttaatgttaccgatgatgtaataaaggattattactacgatgagata
atcactaccatacttgatacaggcatagctgaccattttatcaaggaggtgtgtaaggtc
atacaatccctggctatagacagtcttcatataatcggtgatatctacgacaggggaccg
cgtgctgatatcataatggatgagcttatcaagatgcatgatgtagacatacaatggggt
aatcacgatatttcatggatgggtgcagcctccggcaacagggcgctgatagccaatgtt
atccgtatttctatgaggtataacaatttcgatatacttgaggatggctatggtctgaat
ctgcgtgcacttgctgtttttgccggtgatgtttacaaggatgatccctgtactatattt
atgccccacactcttgatgataatatttacgatcctgttgacactctgcttgttgccaaa
atgcataaagcgatcacagttattcaattgaagcttgaaagtcagctgataaaacgtcat
cctgaatggggaatggatgaccgtgatctgttcagtaatcttcatccggaaaatggcact
gttgaacttaaaggaaagacatacgaactgcttgacaagaattttccaacggtaaataag
gatgaccctctggctctgacagatgaggaaaatgaacttatgaccgtgcttgcgaattca
tttatgcacagcgaaaagcttgctgagcatatgcgttttctttacacgaacggttcaatg
tacaagactatcaatggtaatctactttttcacggttgtatacctctcgatgagaacggt
gagcttctttcagtaaagatagaaggtgaggatcattcgggcaaagaacttcttgataag
cttgatgaggttgcgaacaaagcttattttctccatagcggtgaggaaaaagaaaactca
gctgatttgttatggtacctttggtgcggacctcgttcacccctttacggaaaggataaa
atggcgttttttgaaagatatttcatagatgacccttcactgcatactgagaactataat
gcttattatcagttttctgagaatgcagatgtttgtatgagaatcctggaaatgttcggg
ttggatcctgaaaagggtcatatcatcaacggtcatgttccggtgaaaattaagaatggt
gagagtcctgtgaaggctggcggaaagctttttgttatcgacggcggtatctcaaaagcg
tatcagaaagcgacaggtattgccggatatacccttatttgtgatagccatagtctcaat
cttgctgaacataagcctttcatacccggagagagcgaacatactccaactcttcatctt
gttgaaagattcgagcatcgtgcgaatatatgcgatacagacagaggagaagaacttctt
ggtaagataaacgatcttcgtgaacttctgaaagcgtaccgttcgggcataatcaaacag
aagaaggaaatcgacagaaggacttgttga

DBGET integrated database retrieval system