KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: Riean_0353Help
Entry
Riean_0353        CDS       T01363                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ran  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ran00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Riean_0353
Enzymes [BR:ran01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Riean_0353
    3.5.1.-  
     Riean_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
374273..374878
Genome map
AA seq 201 aa AA seqDB search
MKKALIVVDVQNDFCEGGALAVPNANEIIPYINLLIEENQYDKIIFTQDWHPANHKSFAS
NNDKKVGETISLNGVPQFMWPDHCVENSFGAEFHKDLDISKVDYIVKKGKNPEIDSYSAF
QDNNHFMKTGLADYLKENDIQLVEIVGLALDYCVKYTCLDAVKEGFLTCLHFNGTRAVNV
KPENGRDAIYEMLENGVTILG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcacttatcgtggtagatgttcaaaatgatttctgtgaaggaggagctttg
gctgtacctaacgctaatgaaattatcccttacatcaaccttttaattgaggaaaaccaa
tatgataaaataattttcacacaagattggcaccctgcaaatcacaaatcatttgcatct
aataatgataaaaaagtaggtgaaactatatcactgaacggcgttccacaatttatgtgg
ccagatcattgtgtagaaaattcttttggtgcagaattccataaagacctagatattagt
aaagtagattacattgtaaaaaaaggtaaaaaccctgaaatagatagttatagtgctttt
caggacaataatcattttatgaaaacggggttagctgactatcttaaagaaaacgatata
caattagtagaaattgttggcttagcactagattattgcgttaaatatacttgtttagat
gctgttaaagaaggattcttaacctgtttacactttaatggtactcgtgctgtaaatgta
aaacctgaaaacggaagagatgccatctacgaaatgttagaaaatggtgttaccatttta
ggttaa

DBGET integrated database retrieval system