KEGG   Rhodopirellula baltica: RB9215Help
Entry
RB9215            CDS       T00134                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rba  Rhodopirellula baltica
Pathway
rba00020  Citrate cycle (TCA cycle)
rba00310  Lysine degradation
rba01100  Metabolic pathways
rba01110  Biosynthesis of secondary metabolites
rba01120  Microbial metabolism in diverse environments
rba01130  Biosynthesis of antibiotics
rba01200  Carbon metabolism
Module
rba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RB9215 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RB9215 (sucB)
Enzymes [BR:rba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RB9215 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 1791478
NCBI-ProteinID: NP_868764
UniProt: Q7ULX6
Position
4929311..4930618
Genome map
AA seq 435 aa AA seqDB search
MSDIIPVEVPTVGESISEVQIGNWLKQEGDWVKSGEDLVEIETEKASVQIPAPASGYLQS
ITKQSDEFAEVGQQIASIQVAEQPAGGDGGSSNGGSAPAAGNTASAPAPTASAPAPSSPA
KSGGGFVMPAAQRLLDEHKLDASQVPATGPGGRLLKEDVLAYIRNGSSRPAPAAPPAAPA
APVAPTQQMSSPETASLMTSGGYRSEEVKPMSMLRRTIASRLVQAQQTAALLTTFNEINM
APVMAIRSKYKDAFAKKHGVKLGFMSFFAKATVEALRRYPAVNAEIRGDSMVYRNYQDIG
IAIGGGKGLVVPVLRNVERMSFAEVEGSIAEYARLAGENRLQPSDLMGGTFTISNGGIYG
SLLSTPIVNPPQSGILGLHSIQERPVAEDGQVVIRPMMYVALTYDHRIVDGREAVGFLVA
IKETIEDPARLFLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcattcccgtcgaagttcctaccgttggcgagtcgatcagcgaagtgcaa
atcggcaattggctcaaacaagaaggcgactgggtcaaaagcggcgaagacctcgtcgaa
attgaaacggaaaaagcgtcggtgcaaatccccgctcccgccagcggatacttgcagtcg
atcaccaaacaatccgacgaattcgcagaagtcggccaacaaatcgcctcgatccaagtc
gctgaacaacccgctggcggcgacggcggatcctccaacggcggttcggctcccgcagcc
ggaaacaccgcttcggcaccggccccgacggcatcagcaccggcaccatccagtccagcc
aagagcggcggcggatttgtcatgccagctgcacagcgattgctcgacgaacacaagctg
gacgcatcgcaagttcccgcgaccggccccggtggtcggttgttgaaggaagacgtgctg
gcctacatccgcaacggatcttcgcgacccgcgcccgccgcaccaccggctgctcccgcc
gcaccagttgctccgacacagcaaatgtcttcaccagaaacggcatcgctgatgaccagc
ggtggttaccggtccgaagaagtcaaaccgatgagcatgctgcgtcgcacaatcgcgtcg
cggctcgtccaggctcagcaaaccgccgctttgttgaccacattcaatgagatcaacatg
gcacccgtcatggcgatccgcagcaaatacaaagatgctttcgcgaagaaacatggcgtc
aagcttggcttcatgtcgttctttgcaaaagcgaccgtcgaagccctccgtcgttatccc
gccgtcaacgcggaaatccgcggcgactcgatggtctatcgcaactaccaagacatcggc
atcgcaatcggcggtggcaaaggcttggtcgttccggtccttcgcaacgtggaacgcatg
tcgtttgccgaagtcgaaggcagcattgccgagtacgctcgtctggccggcgaaaaccga
ttgcaaccaagcgacttgatgggtggcacgttcacgatcagcaatggtggcatctacgga
tcgctgctcagcactccaatcgtcaacccaccacaaagcggcatcttgggtctgcactcg
atccaagaacgccccgtcgcggaagatggccaagttgtcatccgcccaatgatgtacgtg
gcgcttacttacgatcaccgcatcgttgacggtcgcgaagcggttggcttcttggtcgcg
atcaaagaaacgatcgaagatccagctcgattgttcttggaagtctga

DBGET integrated database retrieval system