KEGG   Rhodopirellula baltica: RB9215Help
Entry
RB9215            CDS       T00134                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rba  Rhodopirellula baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RB9215 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RB9215 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RB9215 (sucB)
Enzymes [BR:rba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RB9215 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4929311..4930618
Genome map
AA seq 435 aa AA seqDB search
MSDIIPVEVPTVGESISEVQIGNWLKQEGDWVKSGEDLVEIETEKASVQIPAPASGYLQS
ITKQSDEFAEVGQQIASIQVAEQPAGGDGGSSNGGSAPAAGNTASAPAPTASAPAPSSPA
KSGGGFVMPAAQRLLDEHKLDASQVPATGPGGRLLKEDVLAYIRNGSSRPAPAAPPAAPA
APVAPTQQMSSPETASLMTSGGYRSEEVKPMSMLRRTIASRLVQAQQTAALLTTFNEINM
APVMAIRSKYKDAFAKKHGVKLGFMSFFAKATVEALRRYPAVNAEIRGDSMVYRNYQDIG
IAIGGGKGLVVPVLRNVERMSFAEVEGSIAEYARLAGENRLQPSDLMGGTFTISNGGIYG
SLLSTPIVNPPQSGILGLHSIQERPVAEDGQVVIRPMMYVALTYDHRIVDGREAVGFLVA
IKETIEDPARLFLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcattcccgtcgaagttcctaccgttggcgagtcgatcagcgaagtgcaa
atcggcaattggctcaaacaagaaggcgactgggtcaaaagcggcgaagacctcgtcgaa
attgaaacggaaaaagcgtcggtgcaaatccccgctcccgccagcggatacttgcagtcg
atcaccaaacaatccgacgaattcgcagaagtcggccaacaaatcgcctcgatccaagtc
gctgaacaacccgctggcggcgacggcggatcctccaacggcggttcggctcccgcagcc
ggaaacaccgcttcggcaccggccccgacggcatcagcaccggcaccatccagtccagcc
aagagcggcggcggatttgtcatgccagctgcacagcgattgctcgacgaacacaagctg
gacgcatcgcaagttcccgcgaccggccccggtggtcggttgttgaaggaagacgtgctg
gcctacatccgcaacggatcttcgcgacccgcgcccgccgcaccaccggctgctcccgcc
gcaccagttgctccgacacagcaaatgtcttcaccagaaacggcatcgctgatgaccagc
ggtggttaccggtccgaagaagtcaaaccgatgagcatgctgcgtcgcacaatcgcgtcg
cggctcgtccaggctcagcaaaccgccgctttgttgaccacattcaatgagatcaacatg
gcacccgtcatggcgatccgcagcaaatacaaagatgctttcgcgaagaaacatggcgtc
aagcttggcttcatgtcgttctttgcaaaagcgaccgtcgaagccctccgtcgttatccc
gccgtcaacgcggaaatccgcggcgactcgatggtctatcgcaactaccaagacatcggc
atcgcaatcggcggtggcaaaggcttggtcgttccggtccttcgcaacgtggaacgcatg
tcgtttgccgaagtcgaaggcagcattgccgagtacgctcgtctggccggcgaaaaccga
ttgcaaccaagcgacttgatgggtggcacgttcacgatcagcaatggtggcatctacgga
tcgctgctcagcactccaatcgtcaacccaccacaaagcggcatcttgggtctgcactcg
atccaagaacgccccgtcgcggaagatggccaagttgtcatccgcccaatgatgtacgtg
gcgcttacttacgatcaccgcatcgttgacggtcgcgaagcggttggcttcttggtcgcg
atcaaagaaacgatcgaagatccagctcgattgttcttggaagtctga

DBGET integrated database retrieval system