KEGG   Rhodopirellula baltica: RB9215Help
Entry
RB9215            CDS       T00134                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rba  Rhodopirellula baltica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rba01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rba00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rba00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4929311..4930618
Genome map
AA seq 435 aa AA seqDB search
MSDIIPVEVPTVGESISEVQIGNWLKQEGDWVKSGEDLVEIETEKASVQIPAPASGYLQS
ITKQSDEFAEVGQQIASIQVAEQPAGGDGGSSNGGSAPAAGNTASAPAPTASAPAPSSPA
KSGGGFVMPAAQRLLDEHKLDASQVPATGPGGRLLKEDVLAYIRNGSSRPAPAAPPAAPA
APVAPTQQMSSPETASLMTSGGYRSEEVKPMSMLRRTIASRLVQAQQTAALLTTFNEINM
APVMAIRSKYKDAFAKKHGVKLGFMSFFAKATVEALRRYPAVNAEIRGDSMVYRNYQDIG
IAIGGGKGLVVPVLRNVERMSFAEVEGSIAEYARLAGENRLQPSDLMGGTFTISNGGIYG
SLLSTPIVNPPQSGILGLHSIQERPVAEDGQVVIRPMMYVALTYDHRIVDGREAVGFLVA
IKETIEDPARLFLEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcattcccgtcgaagttcctaccgttggcgagtcgatcagcgaagtgcaa
atcggcaattggctcaaacaagaaggcgactgggtcaaaagcggcgaagacctcgtcgaa
attgaaacggaaaaagcgtcggtgcaaatccccgctcccgccagcggatacttgcagtcg
atcaccaaacaatccgacgaattcgcagaagtcggccaacaaatcgcctcgatccaagtc
gctgaacaacccgctggcggcgacggcggatcctccaacggcggttcggctcccgcagcc
ggaaacaccgcttcggcaccggccccgacggcatcagcaccggcaccatccagtccagcc
aagagcggcggcggatttgtcatgccagctgcacagcgattgctcgacgaacacaagctg
gacgcatcgcaagttcccgcgaccggccccggtggtcggttgttgaaggaagacgtgctg
gcctacatccgcaacggatcttcgcgacccgcgcccgccgcaccaccggctgctcccgcc
gcaccagttgctccgacacagcaaatgtcttcaccagaaacggcatcgctgatgaccagc
ggtggttaccggtccgaagaagtcaaaccgatgagcatgctgcgtcgcacaatcgcgtcg
cggctcgtccaggctcagcaaaccgccgctttgttgaccacattcaatgagatcaacatg
gcacccgtcatggcgatccgcagcaaatacaaagatgctttcgcgaagaaacatggcgtc
aagcttggcttcatgtcgttctttgcaaaagcgaccgtcgaagccctccgtcgttatccc
gccgtcaacgcggaaatccgcggcgactcgatggtctatcgcaactaccaagacatcggc
atcgcaatcggcggtggcaaaggcttggtcgttccggtccttcgcaacgtggaacgcatg
tcgtttgccgaagtcgaaggcagcattgccgagtacgctcgtctggccggcgaaaaccga
ttgcaaccaagcgacttgatgggtggcacgttcacgatcagcaatggtggcatctacgga
tcgctgctcagcactccaatcgtcaacccaccacaaagcggcatcttgggtctgcactcg
atccaagaacgccccgtcgcggaagatggccaagttgtcatccgcccaatgatgtacgtg
gcgcttacttacgatcaccgcatcgttgacggtcgcgaagcggttggcttcttggtcgcg
atcaaagaaacgatcgaagatccagctcgattgttcttggaagtctga

DBGET integrated database retrieval system