KEGG   Rickettsia bellii OSU 85-389: A1I_01105Help
Entry
A1I_01105         CDS       T00602                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1I_01105 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1I_01105 (sucC)
   00640 Propanoate metabolism
    A1I_01105 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A1I_01105 (sucC)
Enzymes [BR:rbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A1I_01105 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213348..214505
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDKLNTKVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSVVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGIAYELGFKDHQVKQMKEI
VKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNGLFKHPEIMALRDQDEEDP
LETRAADAGLSYVKMDGSIGCMVNGAGLAMATMDIIKLYGATPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAASKIVEAI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcaaaagagattttaagaaaatacggtgtgcctacttca
actggggtagtggttacaaaaaccgaaagtattaatgcagcgattgataagctaaataca
aaggtttatgtagttaaggcacaaatacatgctggtggtagaggtaaagccggcggtgtt
aaggttgttaagagtaaagaggaagcaaaaaaagttgctcatgatatgttcggtattaat
ttagtcacacaccaaacaggaccacaaggacagaaagtaaatcgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtgtcgtatttgatagatcagctagctgc
atcacctttatagcttctacggagggcggtgttgatattgaagaagttgcagaaaaaact
cctgaaaaaattatcaaattttcagttgatccagctaccggcttgcaaaatttccatgct
caaggaatagcatatgaattaggttttaaagaccatcaagtaaagcaaatgaaagaaata
gtaaaagcaacttacaaagcttttattgaaacagatgcagcacaaattgagattaatccg
ctaattgtaaataaagagggcaatttattagcattagatgcaaaatttacctttgatgat
aatggtctatttaagcaccctgaaattatggctctacgtgatcaagatgaagaagatccg
ttagaaacaagagcagctgatgccggtcttagctatgtgaaaatggatggtagtattggt
tgtatggtaaatggtgcagggcttgctatggcaacaatggatattattaagctttatggt
gcaacacctgcgaatttcctagatgttgggggcggagctgatcgtgaacgtgtgaaagaa
gccttaaaaataattttatctgataaagaagtaaaaggcattttagttaatattttcggc
ggtatcatgcgttgtgatatcatagcagaaggaattatcgcagcagcaaaagatataggt
ataaaagtgccgctagtagtccgcttagctggtacaaatgttgagaaaggtaaagagatt
ttatccaattcaggtttagaaataataccggctcatgatttagctgatgcggctagtaaa
atagtagaagcaatttag

DBGET integrated database retrieval system