KEGG   Rickettsia bellii OSU 85-389: A1I_01105Help
Entry
A1I_01105         CDS       T00602                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00020  Citrate cycle (TCA cycle)
rbo00640  Propanoate metabolism
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
Module
rbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1I_01105 (sucC)
   00640 Propanoate metabolism
    A1I_01105 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A1I_01105 (sucC)
Enzymes [BR:rbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A1I_01105 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABV78617
UniProt: A8GUV0
Position
213348..214505
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGVVVTKTESINAAIDKLNTKVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSVVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQNFHAQGIAYELGFKDHQVKQMKEI
VKATYKAFIETDAAQIEINPLIVNKEGNLLALDAKFTFDDNGLFKHPEIMALRDQDEEDP
LETRAADAGLSYVKMDGSIGCMVNGAGLAMATMDIIKLYGATPANFLDVGGGADRERVKE
ALKIILSDKEVKGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAASKIVEAI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcaaaagagattttaagaaaatacggtgtgcctacttca
actggggtagtggttacaaaaaccgaaagtattaatgcagcgattgataagctaaataca
aaggtttatgtagttaaggcacaaatacatgctggtggtagaggtaaagccggcggtgtt
aaggttgttaagagtaaagaggaagcaaaaaaagttgctcatgatatgttcggtattaat
ttagtcacacaccaaacaggaccacaaggacagaaagtaaatcgtctttatattgaatca
ggttgtgatattttaaaagaatattattttagtgtcgtatttgatagatcagctagctgc
atcacctttatagcttctacggagggcggtgttgatattgaagaagttgcagaaaaaact
cctgaaaaaattatcaaattttcagttgatccagctaccggcttgcaaaatttccatgct
caaggaatagcatatgaattaggttttaaagaccatcaagtaaagcaaatgaaagaaata
gtaaaagcaacttacaaagcttttattgaaacagatgcagcacaaattgagattaatccg
ctaattgtaaataaagagggcaatttattagcattagatgcaaaatttacctttgatgat
aatggtctatttaagcaccctgaaattatggctctacgtgatcaagatgaagaagatccg
ttagaaacaagagcagctgatgccggtcttagctatgtgaaaatggatggtagtattggt
tgtatggtaaatggtgcagggcttgctatggcaacaatggatattattaagctttatggt
gcaacacctgcgaatttcctagatgttgggggcggagctgatcgtgaacgtgtgaaagaa
gccttaaaaataattttatctgataaagaagtaaaaggcattttagttaatattttcggc
ggtatcatgcgttgtgatatcatagcagaaggaattatcgcagcagcaaaagatataggt
ataaaagtgccgctagtagtccgcttagctggtacaaatgttgagaaaggtaaagagatt
ttatccaattcaggtttagaaataataccggctcatgatttagctgatgcggctagtaaa
atagtagaagcaatttag

DBGET integrated database retrieval system