KEGG   Roseiflexus castenholzii DSM13941: Rcas_2024Help
Entry
Rcas_2024         CDS       T00585                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rca  Roseiflexus castenholzii DSM13941
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rca00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2596402..2597874
Genome map
AA seq 490 aa AA seqDB search
MTAMHSTSAATLFPGGQPHIVVVGGGISGMSAAYELGRATRDGAPPVMVTLIEREARLGG
KVVTERNGPFVIEGGPDSFMAQKPWAAELAREIGLGDELMVASPMRRTTWVLIRGRPQPL
PEGMLLIVPTRIAPFAFSPLISPLGKLRMALDLFVPARRDDGDETLADFIRRRLGNEALD
RLAEPILSGIHSAECERQSILATFPRFRELEKRHGSLIRGMLAARRTASPSSAHQSPFMT
LRGGMGTLVERLEQRLTARILTNRRVMALTCDTTAARPYRLWLDDGATLDADAVILATPS
YAAADLVGASFPALADALRAIRYVSTATVSLVYRRSEVGTPLDGYGLVIPRSEQTWINAC
TLSSVKFRHRAPDEYLLLRCFVGGSRRPELLARDDDDLVRMAQSDLRAVLGITAVPLLTR
VYRWHNGNPQYDVGHLERIAALEALCPAGLLLAGAAYRGVGVPDCIKQGREAARRALDVV
ATARYPVMEK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatgcattcgacatcggcggcaacgctgttcccgggcggtcaaccgcacatc
gttgtggtaggcggcgggatcagcggcatgagcgcggcatatgaactggggcgcgcaacg
cgcgacggggcgccgccggtgatggtcacgctcatcgagcgtgaggcgcgtttagggggc
aaggtcgtcaccgagcgcaacggacccttcgtcatcgaaggcggacccgactcgttcatg
gcgcagaaaccatgggctgccgaactggcgcgtgagatcggtctgggtgacgagttgatg
gtcgcctcgccgatgcgccgcacgacatgggtgctgatccgtggacgaccgcaaccgctc
cccgaaggcatgctcctgatcgtccccacacgcatcgcaccctttgccttctcgccgctg
atttctccccttggaaaacttcgtatggcgctcgacttgttcgttccggcgcgccgtgac
gatggcgatgagacgctcgccgactttattcgccgtcgcctggggaatgaggcgcttgat
cgtctggcggagccgatcctctccggcattcacagcgctgagtgcgaacgccagagcatt
ctggcgacctttccgcgcttccgcgagttggagaaacgccatggcagtctgatccgcggc
atgcttgcagcgcggcgcaccgcgtcaccctcttcagcgcatcagtcgcccttcatgacg
ctgcgcggcggcatggggacgctcgtcgagcggttggaacaacgtctcacggcgcgtatc
ctgaccaaccgccgggtgatggcgctcacctgtgatacaaccgctgcgcgtccctatcgt
ctgtggttggacgacggcgccacgctggatgccgatgccgtcattctggcgacgccatcc
tacgccgctgctgacctcgtcggtgcatcgttcccggcgctggcggatgcgttacgcgcc
atccggtacgtttcgaccgccacggtctcactggtctaccggcgcagtgaggtcgggacg
ccgctcgatggctatggtctggtcattccgcgcagcgaacagacctggattaatgcatgc
accctctcctcggttaagtttcgccatcgcgcgcccgatgagtatctgttgctgcgctgc
ttcgtcggcggatcgcgtcgtccagaactgctggcgcgggacgatgacgacctggtgcgc
atggcgcagtccgatctgcgcgccgttctgggcatcaccgccgtgccgctgctgacgcgc
gtgtatcgctggcataacggcaacccgcagtatgatgtcgggcatctggaacgaatcgcc
gcgctcgaggcgctttgtccggcgggtcttttgctggccggcgccgcgtatcgtggcgtt
ggcgtgcccgactgcatcaaacaggggcgtgaggcggcgcgtcgggcgctcgatgtggtt
gcgaccgctcgctatccggtgatggaaaagtaa

DBGET integrated database retrieval system