KEGG   Roseiflexus castenholzii: Rcas_2024Help
Entry
Rcas_2024         CDS       T00585                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rca  Roseiflexus castenholzii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rcas_2024
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Rcas_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2596402..2597874
Genome map
AA seq 490 aa AA seqDB search
MTAMHSTSAATLFPGGQPHIVVVGGGISGMSAAYELGRATRDGAPPVMVTLIEREARLGG
KVVTERNGPFVIEGGPDSFMAQKPWAAELAREIGLGDELMVASPMRRTTWVLIRGRPQPL
PEGMLLIVPTRIAPFAFSPLISPLGKLRMALDLFVPARRDDGDETLADFIRRRLGNEALD
RLAEPILSGIHSAECERQSILATFPRFRELEKRHGSLIRGMLAARRTASPSSAHQSPFMT
LRGGMGTLVERLEQRLTARILTNRRVMALTCDTTAARPYRLWLDDGATLDADAVILATPS
YAAADLVGASFPALADALRAIRYVSTATVSLVYRRSEVGTPLDGYGLVIPRSEQTWINAC
TLSSVKFRHRAPDEYLLLRCFVGGSRRPELLARDDDDLVRMAQSDLRAVLGITAVPLLTR
VYRWHNGNPQYDVGHLERIAALEALCPAGLLLAGAAYRGVGVPDCIKQGREAARRALDVV
ATARYPVMEK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatgcattcgacatcggcggcaacgctgttcccgggcggtcaaccgcacatc
gttgtggtaggcggcgggatcagcggcatgagcgcggcatatgaactggggcgcgcaacg
cgcgacggggcgccgccggtgatggtcacgctcatcgagcgtgaggcgcgtttagggggc
aaggtcgtcaccgagcgcaacggacccttcgtcatcgaaggcggacccgactcgttcatg
gcgcagaaaccatgggctgccgaactggcgcgtgagatcggtctgggtgacgagttgatg
gtcgcctcgccgatgcgccgcacgacatgggtgctgatccgtggacgaccgcaaccgctc
cccgaaggcatgctcctgatcgtccccacacgcatcgcaccctttgccttctcgccgctg
atttctccccttggaaaacttcgtatggcgctcgacttgttcgttccggcgcgccgtgac
gatggcgatgagacgctcgccgactttattcgccgtcgcctggggaatgaggcgcttgat
cgtctggcggagccgatcctctccggcattcacagcgctgagtgcgaacgccagagcatt
ctggcgacctttccgcgcttccgcgagttggagaaacgccatggcagtctgatccgcggc
atgcttgcagcgcggcgcaccgcgtcaccctcttcagcgcatcagtcgcccttcatgacg
ctgcgcggcggcatggggacgctcgtcgagcggttggaacaacgtctcacggcgcgtatc
ctgaccaaccgccgggtgatggcgctcacctgtgatacaaccgctgcgcgtccctatcgt
ctgtggttggacgacggcgccacgctggatgccgatgccgtcattctggcgacgccatcc
tacgccgctgctgacctcgtcggtgcatcgttcccggcgctggcggatgcgttacgcgcc
atccggtacgtttcgaccgccacggtctcactggtctaccggcgcagtgaggtcgggacg
ccgctcgatggctatggtctggtcattccgcgcagcgaacagacctggattaatgcatgc
accctctcctcggttaagtttcgccatcgcgcgcccgatgagtatctgttgctgcgctgc
ttcgtcggcggatcgcgtcgtccagaactgctggcgcgggacgatgacgacctggtgcgc
atggcgcagtccgatctgcgcgccgttctgggcatcaccgccgtgccgctgctgacgcgc
gtgtatcgctggcataacggcaacccgcagtatgatgtcgggcatctggaacgaatcgcc
gcgctcgaggcgctttgtccggcgggtcttttgctggccggcgccgcgtatcgtggcgtt
ggcgtgcccgactgcatcaaacaggggcgtgaggcggcgcgtcgggcgctcgatgtggtt
gcgaccgctcgctatccggtgatggaaaagtaa

DBGET integrated database retrieval system