KEGG   Rickettsia canadensis McKiel: A1E_05645Help
Entry
A1E_05645         CDS       T00603                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rcm  Rickettsia canadensis McKiel
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    A1E_05645
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    A1E_05645
Enzymes [BR:rcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     A1E_05645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153145..1153411
Genome map
AA seq 88 aa AA seqDB search
MAENNITVNAICPGYVNIPLVKNQIADTAKARNISGESALQDVILKSHATKKFVEADEIA
NLVIFLCDEKASSITGSGLLIDGGWTAQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaataatattacagttaatgctatttgcccgggttatgttaatattccctta
gtcaagaatcaaatagcagatactgctaaagctagaaatatcagtggagaatcagcatta
caagatgtaatcctaaaatctcacgccacaaaaaaatttgtcgaagctgatgaaatagca
aacttagtaatattcttatgtgacgaaaaagcatcatcaataacaggtagtggactcttg
atagatggcggctggacggcacagtag

DBGET integrated database retrieval system