KEGG   Rickettsia conorii: RC1298Help
Entry
RC1298            CDS       T00061                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rco  Rickettsia conorii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202198..1202401)
Genome map
AA seq 67 aa AA seqDB search
MPLTENQQAALISFIFNCGAGAFQASTLQQKLNRGEYANAANELLRWMCAKGGLKLQGLV
KRQYYRL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gtgccattaaccgaaaaccaacaagccgccttaatctcgtttattttcaactgtggggct
ggggcatttcaagcatcaacattgcagcaaaagctaaacagaggtgaatatgcaaacgct
gctaacgagttactgcgatggatgtgtgctaaaggcggtcttaagctgcaaggcttagtg
aaacgtcaatattatagattataa

DBGET integrated database retrieval system