KEGG   Rhodobacter capsulatus: RCAP_rcc01129Help
Entry
RCAP_rcc01129     CDS       T01213                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta-1 subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rcp  Rhodobacter capsulatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCAP_rcc01129 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RCAP_rcc01129 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCAP_rcc01129 (trpB1)
Enzymes [BR:rcp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RCAP_rcc01129 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1200908..1202140
Genome map
AA seq 410 aa AA seqDB search
MAEDRLNSFMTAPDESGRFGIHGGRFVSETLMPLILELEAQYEHAKTDPSFWAEMEALWK
HYVGRPSPLYFAPRMTEELGGAKVYLKREELNHTGAHKINNVLGQILLARRMGKTRIIAE
TGAGQHGVATATVCAKFGLQCIVYMGATDVERQAPNVFRMKLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPAPYPAMVRDFQSIIGKETRWQLQEQEGEGRLPDTI
IACVGGGSNAMGLFHPFLDDPSVRIIGVEAGGLGVDDRMQHCASLTGGRPGVLHGNRTYL
LQDEDGQILEGHSISAGLDYPGIGPEHSWLHDIKRAEYVSISDAEALDAFQFCCRTEGII
PALESSHALAHVMKLAPTLPKDHIIVVNLSGRGDKDIFTVAKHLGVEMKV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagatcggctcaacagtttcatgacggctccggacgagagcggccggttcggc
attcacggcgggcgcttcgtgtccgaaacgctgatgccgctgatccttgaactcgaggcg
caatacgagcacgccaagaccgacccgagcttctgggccgagatggaggcgctttggaag
cattacgtcggccgtccctcgccgctttatttcgcgccgcggatgaccgaggagctgggc
ggcgccaaagtctatctgaagcgcgaggagctgaaccacaccggcgcgcacaagatcaac
aacgtgctggggcagattttgctcgcccggcgcatgggcaagacccggatcatcgccgag
accggggcggggcagcatggcgtggcgacggccaccgtctgcgcgaagttcgggctgcaa
tgcattgtttacatgggcgccaccgacgttgaacgtcaggcgccgaacgtgttccggatg
aagttgctcggcgccgaggtggtgccggtgacctctggtcgcggcacgctgaaagatgcg
atgaacgatgctttgcgcgactgggtgaccaatgtgcgcgacacgttctattgcatcggc
accgtcgcggggcctgcgccctatccggcgatggtgcgggatttccagtcgatcatcggc
aaggaaacccgctggcagctgcaggaacaagagggcgaaggccgtctgcccgacacgatc
atcgcctgcgtcggcggcggctcgaacgccatggggctgttccatccgttcctggatgac
ccttcggtgcgcatcatcggggtcgaggccggagggcttggggtggacgaccggatgcag
cattgcgcgtccttgaccggcgggcgcccgggcgtgctgcatggcaaccgcacctatctg
ttgcaggacgaggacgggcagatcctggaggggcattcgatctcggccggccttgattat
ccgggcatcgggccggagcattcgtggctgcatgacatcaagcgcgccgaatatgtctcg
atctccgatgccgaggcgctcgacgccttccagttctgctgtcggaccgaggggatcatt
ccggccttggaaagcagccatgcgctcgcccatgtgatgaaactcgcgccgacgctgccg
aaagaccacatcatcgtggtcaacctctcgggccggggcgacaaggacattttcaccgtg
gcgaagcacctgggcgtcgagatgaaggtctga

DBGET integrated database retrieval system