KEGG   Roseobacter denitrificans: RD1_0819Help
Entry
RD1_0819          CDS       T00376                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
rde  Roseobacter denitrificans
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:rde00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RD1_0819
Enzymes [BR:rde01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     RD1_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RoseoBase: 
UniProt: 
Position
complement(801282..802295)
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRRFLAHLPTPLERLDRLTKELGGPEIWIKRDDCTGMSTGGNKTRKLEFLMAEA
ELQGADMIITQGATQSNHARQTAAFAAKMGMQCHIVLEDRTASNNTNYNNNGNVLLDHLH
GATTEKRPGGGDFNALIEDMAEQMRADGKKVYAIPGGGSNPTGALGYVNCAFELLNQVNS
SGMKIDHIVTATGSAGTQAGLIVGLKAMNAQIPLLGIGVRAPKAKQEENVFNLACKTADK
LGCPGVVERHDVVANTDYVGEGYGIPTESGLEAIRMFAELEAILLDPVYSAKGAAGFIDL
IRKGHFKKGERVVFLHTGGSVALFGYDSAFDFSDRWS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatctggcccgtttcccccgccgatttcttgcgcacttgccaacaccgcttgagcgt
cttgaccgcctgaccaaagaactgggcgggccggaaatatggatcaaacgagatgactgc
acaggcatgtccacgggcggcaacaagacccgcaagctggaattcctgatggccgaagct
gaattgcaaggcgctgatatgatcatcacgcaaggggccacgcaatccaaccatgcccgt
caaaccgcagctttcgccgccaagatgggcatgcagtgtcacatcgttctggaagaccgc
accgcgtcgaacaacaccaactacaacaacaatggcaacgtcttgctggaccatctgcac
ggtgccacgaccgaaaaacgcccgggcggtggggatttcaacgcgttgatcgaagacatg
gctgagcagatgcgcgcggatggcaaaaaggtttacgccatccccggcggcggatcgaac
ccgacgggggcattgggctatgtgaactgcgccttcgaactgctgaatcaggtcaacagc
agcgggatgaagatcgatcatatcgtcacggcgacaggcagtgccggaacgcaggcgggt
ctgattgtcgggctaaaggcaatgaatgcgcagattccccttttgggcatcggcgtgcgc
gcgcccaaagccaagcaggaagagaacgtcttcaaccttgcgtgcaagaccgcggacaag
ctggggtgccccggtgtagtcgagcggcacgacgtcgtggccaacacggattatgtcggc
gaaggttacggcatcccgaccgagagcgggcttgaggcgatccggatgtttgccgaactt
gaggcgatccttctggatccggtctactcggccaagggtgccgccgggttcatcgatttg
atccgcaagggacatttcaagaagggcgaacgcgttgtcttcctgcataccggcggatcc
gtagcgctgttcggatacgattctgcctttgatttttccgatcgctggtcctga

DBGET integrated database retrieval system