KEGG   Rhizobium etli CIAT 652: RHECIAT_PB0000142Help
Entry
RHECIAT_PB0000142 CDS       T00720                                 

Gene name
pgmY
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHECIAT_PB0000142 (pgmY)
   01230 Biosynthesis of amino acids
    RHECIAT_PB0000142 (pgmY)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_PB0000142 (pgmY)
  Energy metabolism
   00680 Methane metabolism
    RHECIAT_PB0000142 (pgmY)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_PB0000142 (pgmY)
Enzymes [BR:rec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHECIAT_PB0000142 (pgmY)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHECIAT_PB0000142 (pgmY)
  Exosomal proteins of melanoma cells
   RHECIAT_PB0000142 (pgmY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pB:complement(157699..158328)
Genome map
AA seq 209 aa AA seqDB search
MSTLVIVRHGQSEGNARGEFTGTSDVPLTQEGWSESRRAGSLLANLGISFDIAFSSALLR
TVDTCRAILNETNGDLLEPIRRTELNERDYGQLTGINKNVARERWGQDVVQVWRRSYSTP
PPGGESIRDISARVLPFLISEVFPPLLRGKSVLVVAHGNTIRSLKQGIERLTIQDTLAIE
SPTATPTVYRIASDLSIIEKTNVLVGTVC
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctggtgattgtccggcatggccaaagcgaagggaacgcgcgcggggagttc
acgggtacgagcgacgtgccgctcacacaggagggctggtctgagagcaggcgagccggc
tcactgctcgcgaacctcggcatctcgttcgatattgcgtttagctccgccctcttgcgc
acagtcgacacttgcagagcgattttgaacgaaaccaacggcgatctgctggagccaatc
aggagaaccgagttgaacgaacgcgactacggacagctcaccggcatcaacaagaacgtg
gcacgtgagcggtggggccaggatgttgtccaggtttggcgccgctcgtacagcactcca
ccacctgggggagaaagcatacgggacataagcgcgagggttctgccctttttgataagc
gaagtgttcccccccttgttgagagggaaatcggttcttgtggtggcccacgggaatacg
atcaggtcactaaagcagggcatcgaacgcctcacgatccaggatacgctcgctattgag
tcaccgaccgccacgccaactgtataccggattgcgtcggacctctcgatcatcgagaag
actaacgtcctggttggtactgtctgttaa

DBGET integrated database retrieval system