KEGG   Rhizobium etli CIAT 652: RHECIAT_PB0000142Help
Entry
RHECIAT_PB0000142 CDS       T00720                                 

Gene name
pgmY
Definition
(GenBank) phosphoglycerate mutase protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rec  Rhizobium etli CIAT 652
Pathway
rec00010  Glycolysis / Gluconeogenesis
rec00260  Glycine, serine and threonine metabolism
rec00680  Methane metabolism
rec01100  Metabolic pathways
rec01110  Biosynthesis of secondary metabolites
rec01120  Microbial metabolism in diverse environments
rec01130  Biosynthesis of antibiotics
rec01200  Carbon metabolism
rec01230  Biosynthesis of amino acids
Module
rec_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHECIAT_PB0000142 (pgmY)
  Energy metabolism
   00680 Methane metabolism
    RHECIAT_PB0000142 (pgmY)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHECIAT_PB0000142 (pgmY)
Enzymes [BR:rec01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHECIAT_PB0000142 (pgmY)
Membrane trafficking [BR:rec04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    RHECIAT_PB0000142 (pgmY)
Exosome [BR:rec04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHECIAT_PB0000142 (pgmY)
  Exosomal proteins of melanoma cells
   RHECIAT_PB0000142 (pgmY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACE93855
UniProt: B3Q2E9
Position
pB:complement(157699..158328)
Genome map
AA seq 209 aa AA seqDB search
MSTLVIVRHGQSEGNARGEFTGTSDVPLTQEGWSESRRAGSLLANLGISFDIAFSSALLR
TVDTCRAILNETNGDLLEPIRRTELNERDYGQLTGINKNVARERWGQDVVQVWRRSYSTP
PPGGESIRDISARVLPFLISEVFPPLLRGKSVLVVAHGNTIRSLKQGIERLTIQDTLAIE
SPTATPTVYRIASDLSIIEKTNVLVGTVC
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctggtgattgtccggcatggccaaagcgaagggaacgcgcgcggggagttc
acgggtacgagcgacgtgccgctcacacaggagggctggtctgagagcaggcgagccggc
tcactgctcgcgaacctcggcatctcgttcgatattgcgtttagctccgccctcttgcgc
acagtcgacacttgcagagcgattttgaacgaaaccaacggcgatctgctggagccaatc
aggagaaccgagttgaacgaacgcgactacggacagctcaccggcatcaacaagaacgtg
gcacgtgagcggtggggccaggatgttgtccaggtttggcgccgctcgtacagcactcca
ccacctgggggagaaagcatacgggacataagcgcgagggttctgccctttttgataagc
gaagtgttcccccccttgttgagagggaaatcggttcttgtggtggcccacgggaatacg
atcaggtcactaaagcagggcatcgaacgcctcacgatccaggatacgctcgctattgag
tcaccgaccgccacgccaactgtataccggattgcgtcggacctctcgatcatcgagaag
actaacgtcctggttggtactgtctgttaa

DBGET integrated database retrieval system