KEGG   Ralstonia eutropha H16: H16_B2320Help
Entry
H16_B2320         CDS       T00416                                 

Definition
cytochrome c2 precursor
Orthology
K08738  
cytochrome c
Organism
reh  Ralstonia eutropha H16
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    H16_B2320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H16_B2320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2629047..2629424)
Genome map
AA seq 125 aa AA seqDB search
MRRTAFVLLALAAFTAVPTAATAADIQAGKALFATRCASCHHVGRNARAGFGPQLNGIFG
RAAGGTSDFQYSEAMRASKVVWSHDTLRAFIHSPGKVVPGTKMRFWGLSDDKQISDLLAY
LQTLQ
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtaccgcctttgtcctgctggccctggccgccttcaccgccgtccccaccgca
gccactgccgccgatatccaggccggcaaggcactcttcgccacgcgctgcgcctcgtgc
catcacgtcggccgcaacgcgcgcgcaggctttggcccgcagctgaacggcatcttcggc
cgcgccgcgggcggcaccagcgatttccagtattcggaggcgatgcgcgcttcaaaggtg
gtgtggtcgcatgacacgctgcgtgccttcatccattcgcccggcaaggtcgtgcctggc
accaagatgcgcttctgggggctcagtgacgacaagcagatcagcgatctgctggcttac
ctgcagacattgcagtag

DBGET integrated database retrieval system