KEGG   Rhodococcus erythropolis PR4: RER_32170Help
Entry
RER_32170         CDS       T00881                                 

Gene name
glcB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_32170 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_32170 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    RER_32170 (glcB)
Enzymes [BR:rer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RER_32170 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3488108..3490291
Genome map
AA seq 727 aa AA seqDB search
MTERVQVGSLQVAKVLYDFVVEEALPGTGVDAETFWAGADKVITELAPKNRDLLAKRDDL
QAQIDQWHRDHAGAPIDAAAYKAFLQEIGYLLPTPAEFSVTTANVDTEITSTAGPQLVVP
ILNARFALNASNARWGSLYDALYGTNAISEENGAEKGSGYNKVRGDKVIAWAREFLDAAA
PLASGSHADSTKYVIDGSELKITLADGTVTTLAQPEKFVGYLGAKDAPTSILLLNNGLHA
EIQIDASSPIGSTDAAGVKDVVLESAVTTIMDFEDSVAAVDADDKVVGYRNWLGLNRGDL
SEEIKKGAKSFTRTLNGDRKYTAVDGSELSLHGRSLLFVRNVGHLMTNPAILDADGNEVP
EGILDALITSTCAVHGLSISDANGPLDNSRTGSIYIVKPKQHGPEEVAFTTELFGRVEQV
LGLPENTLKVGIMDEERRTTVNLAACIKEAVDRVVFINTGFLDRTGDEIHTSMEAGAMVR
KAEMKKQKWIGAYEDWNVDTGLACGLQGKAQIGKGMWAMTELMADMLEQKIGHPKAGANT
AWVPSPTGATLHATHYHRVDVFAVQDSLKGKPRASVDDILTIPLAPSTDWTDAEKKEELD
NNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVSESDVV
SALERMAPVVDRQNEGDAEYRNMAPDFDSNIAFQAAKELILEGAKQPSGYTEPILHRRRR
EYKAANA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaggtcggcagtcttcaggttgccaaggttctctacgacttcgtg
gtcgaggaggctcttcccggcaccggtgtagacgccgagacgttctgggccggcgccgac
aaggtcatcaccgagctcgcaccgaagaaccgcgatttgcttgccaagcgtgacgatctg
caggctcagatcgatcagtggcatcgcgatcatgccggcgctcccatcgacgctgccgca
tacaaggcgttcctgcaggagatcggctacctcctgccgacgcctgccgagttctcggtc
accaccgcgaacgtcgacactgagatcacctcgacggccggcccgcagttggtcgtgccg
atcctcaacgcgcgcttcgctctcaacgcgtccaacgcccgctggggttcgttgtacgac
gcgctgtacggcactaacgccatctcggaggagaacggcgccgagaagggttccggctac
aacaaggtccgcggcgacaaggtcatcgcctgggcgcgtgaattcctcgacgcggcagca
cctctcgcgtcggggtcgcatgcagattcgaccaagtacgtgatcgacggcagtgaactg
aagatcacgttggcagacggtacggtcaccaccctcgcccagccggagaagttcgtcggc
tacctcggcgcgaaggacgcaccgacgagcatcctgctgctcaacaacggattgcacgcc
gagatccagatcgatgcgtcctccccgatcggcagcaccgacgccgccggtgtcaaggac
gtcgttctcgaatcggccgtcaccacgatcatggacttcgaggactcggtcgccgctgtc
gacgccgacgacaaggttgtcggttaccggaactggttgggcctcaatcgcggtgatctg
tccgaggagatcaagaagggcgccaagtccttcactcgtacgctcaacggcgaccgtaag
tacaccgccgtcgacggcagcgaactcagcctgcacggtcgttcgctcctgttcgtccgc
aacgtcggtcacctcatgaccaatcccgcgatcctcgatgccgacggcaacgaggtcccc
gagggcattctcgacgctttgatcacgagcacctgtgcagtgcacggcctctcgatcagt
gacgccaacggcccgctcgacaacagccgcaccggctcgatctacatcgtcaagcccaag
cagcacggccccgaggaagttgccttcaccaccgaactgttcggccgcgtcgagcaggtc
ctcgggcttcccgagaacacgctcaaggtcggcatcatggacgaggagcgtcgcacgaca
gtcaacctcgctgcctgcatcaaggaagccgtcgaccgcgtcgtgttcatcaacaccggc
ttcctcgaccgcaccggcgacgagatccacacctccatggaagccggcgcgatggtgcgc
aaggccgagatgaagaagcagaagtggatcggtgcctacgaggactggaacgtcgacacc
ggactggcctgcggcctgcagggcaaggcgcagatcggcaagggcatgtgggccatgacc
gagctgatggcagacatgctcgagcagaagatcggccaccccaaggccggcgccaacacc
gcgtgggttccttcgccaaccggcgcaacgctgcacgcgacgcactaccaccgcgtcgac
gtgttcgctgttcaggacagcctgaagggcaagccgcgtgcgagcgtcgacgacatcctg
accatcccgctcgctcccagcaccgactggacggacgcggagaagaaggaagagctcgac
aacaactgccagtccatcctcggctacgtcgtccgctggatcgacgcgggtgtcggctgc
tccaaggttcccgacatccacgatgtcgcgctcatggaggaccgcgccaccctgcgcatc
tcgagccagctgctcgccaactggctgcgtcacggcatcgtcagcgagagcgacgttgtc
agtgcactcgagcgcatggccccggttgtcgaccgtcagaacgagggcgacgccgagtac
cgcaacatggcacctgatttcgattccaacatcgcgttccaggctgccaaggaactcatc
ctcgaaggcgcgaagcagcccagcggatacacggagccgatcctgcatcgccgccgccgc
gagtacaaggctgccaacgcctga

DBGET integrated database retrieval system