KEGG   Ralstonia eutropha JMP134: Reut_A1992Help
Entry
Reut_A1992        CDS       T00268                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Reut_A1992
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Reut_A1992
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Reut_A1992
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Reut_A1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2182143..2183591)
Genome map
AA seq 482 aa AA seqDB search
MKYQSTRGHEVPQSFSEILLGGLAPDGGLYLPVQYPQVTADELEAWRKLSYADLAFEILS
KFCDDIPAEDLRALTRKTYTAEVYCNARAGDNTADITPLRTLGEEGGTKLQLLGLSNGPT
LAFKDMAMQLLGNMFEYALGRAGLELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDLEYKARQRIGTVNSINWARVV
AQVVYYFKGWLLATTGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFIFDLLGQDAGKLAALFRDVDEKGGF
DLSGTPEYERIRGEFGFVSGRSTHGDRVATIRDMSARYGITIDTHTADGIKVAREHLSAD
VPMVVLETALPAKFADTIREALGHEPERPAAFEGIEKLPQRFEVMANDASQVKAFIAGHT
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccacgaagtgccgcaatcgttctctgaaatcctgctg
ggcggcctggcgccggacggcggcctgtacctgcccgtgcagtacccacaggtcaccgcc
gacgagctggaggcctggcgcaagctgtcgtacgccgacctggcgttcgagatcctgagc
aagttctgcgacgatatcccggccgaggacctgcgcgcgctgacgcgcaagacctatacc
gccgaggtgtactgcaacgcgcgcgccggcgataacaccgccgacatcacgccgctgcgc
acgctgggcgaggaaggcggcacgaagctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggccatgcaactgctcggcaatatgttcgagtacgcgctgggc
cgtgccgggctggagctcaacatcctgggcgccacgtccggcgataccggcagcgctgcc
gaatacgcgatgcgcggcaagcgcggcatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaagatccgaacatcttcaacctg
gcggtggaaggtgtgttcgatgattgccaggacatcgtcaaggcggtctcgaacgacctc
gaatacaaggcccgccagcgtatcggtacggtcaattcgatcaactgggcgcgtgtggtg
gcccaggtcgtgtactacttcaagggctggctgctcgcgaccacgggcccaggccagaag
gtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggtttgccgatcgacaagctcgtggttgccaccaacgagaacgacgtactcgac
gagttcttccgcacaggcgcctaccgtgtgcgcaagtcggccgagacttaccatacgtcg
agcccgagcatggatatctcgaaggcgtcgaacttcgaacgcttcatcttcgacctgctc
ggccaggacgccggcaagctggccgcgctgttccgcgatgtggacgagaagggcggcttc
gacctgtcggggacgcccgagtacgagcgcatccgcggcgagtttggctttgtctcgggc
cgcagcacgcacggggaccgcgtggcgacgatccgcgacatgtcggcgcgctatggcatc
acgatcgatacccataccgcggatggcatcaaggtggcgcgtgagcatctcagcgccgac
gtgccgatggtagtgctggaaaccgcgctgccggccaagtttgccgacaccatccgtgaa
gcgctgggccacgagcccgagcgcccggcggcgttcgaaggcatcgagaagctgccgcag
cgcttcgaggtgatggccaacgacgccagccaggtcaaggcctttatcgctggtcacacc
ggcctgtaa

DBGET integrated database retrieval system