KEGG   Rubrivivax gelatinosus: RGE_35440Help
Entry
RGE_35440         CDS       T01803                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rge  Rubrivivax gelatinosus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rge00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RGE_35440 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RGE_35440 (cheB)
Enzymes [BR:rge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RGE_35440 (cheB)
Two-component system [BR:rge02022]
 CheA family
  CheA-CheYBV
   RGE_35440 (cheB)
Bacterial motility proteins [BR:rge02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RGE_35440 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3788687..3789769
Genome map
AA seq 360 aa AA seqDB search
MSKTRVVVVDDSALVRGLLAEIINRQPDMTCIGAAADPLVAREMIRNLNPDVITLDVEMP
RMDGIDFLSRLMRLRPMPVVMVSTLTERGAEVTMKALELGAVDFVAKPKIGVADGLRQLG
DDITEKIRAATKARVHRLAPAPAAAGGGAAKPVSVSPLGRLSTEKIIFIGASTGGTEATR
EGITQLPPDSPAVMITQHMPPGFTKSYAARLNGLARIRVAEAVDGERVLPGHAYIAPGGL
HLSVERSGANYIARVRDGDPVNRHKPSVEVLFQSAARVVGQNALGVMLTGMGADGARAMR
EMRDAGSWNVAQDEATCVVFGMPREAIAHGAAHEVLPLQRIAPALIERLRSTAGLATTRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacccgcgtcgtcgtcgtcgacgattccgctctcgtacgcggcctgctggcc
gagatcatcaaccgccagccggacatgacctgcatcggcgccgccgccgacccgctggtg
gcgcgcgagatgatccgcaacctgaaccccgacgtcatcacgctggacgtcgagatgccg
cgcatggacggcatcgacttcctgtcgcgcctgatgcggctgcggccgatgccggtggtg
atggtctcgacgctgaccgaacgcggcgccgaggtgacgatgaaggcgctggaactgggc
gccgtcgacttcgtcgccaagcccaagatcggcgtcgccgacggcctgcgccagctgggc
gacgacatcaccgagaagatccgcgccgcgaccaaggcccgcgtgcaccgcctggcgccg
gctccggccgccgccggcggcggcgccgccaagccggtgtcggtgagcccgctgggccgg
ctgtcgaccgagaagatcatcttcatcggcgcctccaccggcggcaccgaagcgacgcgc
gaaggcatcacccagctgccgccggactcgccggcggtgatgatcacccagcacatgccg
ccgggcttcacgaagagctacgccgcgcggctgaacgggctggcgcgcatccgcgtcgcc
gaggccgtggacggcgagcgcgtgctgccgggccacgcctacatcgccccgggcggcctg
catttgtcggtggagcgttcgggcgccaactacatcgcccgcgtgcgcgacggcgacccg
gtgaaccgccacaagccctcggtcgaggtgctgttccagtcggcggcgcgggtggtcggc
cagaacgcgctgggcgtgatgctcaccggcatgggcgccgacggcgcgcgcgcgatgcgc
gagatgcgcgacgccggcagctggaacgtggcccaggacgaagcgacctgcgtcgtcttc
ggcatgccgcgcgaagcgatcgcccacggcgcggcgcacgaggtgctgccgctgcagcgc
atcgccccggcgctgatcgagcgcctgcgcagcaccgccggcctggccaccacgcgggtc
tga

DBGET integrated database retrieval system