KEGG   Rickettsia heilongjiangensis: Rh054_04380Help
Entry
Rh054_04380       CDS       T01587                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rh054_04380
Enzymes [BR:rhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rh054_04380
Exosome [BR:rhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rh054_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754875..755867)
Genome map
AA seq 330 aa AA seqDB search
MYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQEIKTMPGIYRLSIDQI
VETAKEAAELGINVIALFPSIDQSLKSENADEAYNLDNLICRTIRSIKNANIDIGIICDV
ALDPYTTHGHDGIVHHGEVDNDRSVRALCNQALVLAKAGLDIVAPSDMMDGRIRAIREYL
DKEGFINVGILAYAAKYASSFYGPFRDAVKSNKKNYLDKSSYQMDVRNIKEAMLEIEHDI
AEGADIVMVKPGMPFLDVIREAANNFNVKIFAYQVSGEYAMLKFAAEAGAIDWERALMES
LISFKRAGATGIFTYAALEVAEILKNNKIK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtatccccatattagacttagaagaaatagaaaagctttttggcttagagagttaata
tccgaaagtaatttatcggttagtgatttagtgttgcctttatttgttgttgaaggacat
aatgaaaggcaagaaattaaaactatgcctggtatatatcgtttatcgattgatcaaata
gtagaaacggcaaaagaagcagcagagcttggtattaatgttattgcattatttccgagt
attgatcaaagtctaaaaagtgaaaatgccgatgaggcttataatttagataatttaata
tgtagaactattagaagcatcaaaaacgctaatatcgatattggtataatatgcgatgta
gcacttgatccttatactacacatggtcatgatggtattgtgcatcatggggaagttgat
aatgatagatcagtaagagctttgtgtaatcaggcattagtgctagcaaaagctggatta
gatattgttgcaccttccgatatgatggatggaagaatcagggctataagggaatatctt
gacaaagagggatttataaatgttggaattcttgcttatgccgctaaatatgcgtcaagt
ttttacggtccgtttcgcgatgctgttaagagtaataaaaagaattatttagataaatca
agctatcaaatggatgtacgtaatattaaggaagcaatgcttgagattgagcatgacata
gcagagggagccgatatagtaatggtgaagcctggtatgccgtttttggatgttattcgt
gaagcggcaaataattttaatgttaaaatttttgcatatcaggttagtggagaatatgca
atgttaaaatttgcagcagaagcaggggcaattgattgggagagagctttgatggagtca
ttaattagttttaaacgtgccggtgccacaggtatatttacctatgcagctcttgaagta
gctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system