KEGG   Sinorhizobium fredii NGR234: NGR_c28950Help
Entry
NGR_c28950        CDS       T00888                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NGR_c28950 (glgB)
Enzymes [BR:rhi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NGR_c28950 (glgB)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGR_c28950 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3032523..3034733
Genome map
AA seq 736 aa AA seqDB search
MTSPPGKDETPAASGFLPAQEIEAILSGTHSDPFAVLGVHACGKSYVARCFIPGAATVVA
ETLSGDEVGALERRHDAGFFEGPVSLRKTQPVRYRARNAGGEWIVVDPYSFGPVLGPMDD
YYIREGSHLRLFDKLGAHPIAHDGAEGFHFAVWAPNARRVSVVGGFNDWDGRRHVMRRRA
DTGIWEIFVPGVPIGSPYKYEILGKDGTLLPLKADPFARRSELRPDTASVTTGEIVQVWE
DEAHRRHWDEVDPRRQPISIYEVHASSWQRRDNGDMLSWDELAERLIPYCVDMGFTHIEF
LPISEFPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKAGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHEDPRQGFHPDWNTAIYNFGREEVAAYLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRQHGEWVPNEYGGNENLEAVRFLQTMNSRLYGIHQGVLTIAEESTSWPKV
SHPVHTGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYAFMWGYPGKKLLFMGQEFAQWREWSEERQLDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGEGFEWLIADDRDNSVFAWLRKAPGE
KLVAVVTNYTPVYREGYDVPLPVAGRWKEILNTDAEIYGGSGKGNGGAVQAEKKSNGRTM
ATVTLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaccgcccggcaaggacgaaacgcccgctgcatcaggctttctgccggcgcag
gaaatcgaggcaatactttccggcacccatagcgatccgtttgccgttctcggtgtgcat
gcatgcggcaagagctatgtcgcgcgctgcttcatccccggcgctgcaacggtggtcgcg
gagaccctgtccggcgacgaggtcggagccctggagcggcgccacgacgcggggtttttc
gaaggccccgtctcgcttcgcaagacgcagccggtccgctaccgggcccgcaacgcgggc
ggcgaatggatcgtggtcgatccctacagtttcggtcccgtccttgggccgatggacgac
tactacatccgcgaaggctcacatctccggctcttcgacaagctaggggcccacccgatc
gcccatgacggtgccgaaggctttcatttcgccgtctgggcgccgaacgcgcggcgcgtc
tccgtcgtcggcggcttcaacgactgggacgggcgccgccatgtcatgcggcgacgcgcc
gacaccggcatctgggagatcttcgttcccggcgtgccgatcggctccccctataaatac
gagatcctcggcaaggacggcaccctgctgccgctgaaggccgatcccttcgcccgtcgc
tcggaattgcgccccgacaccgcatcggtaacgacgggagaaatcgtccaggtgtgggag
gacgaggcacaccggcggcactgggatgaggtcgatccgcgccgccagccgatttccatc
tacgaggtccatgccagctcgtggcagcgccgcgacaacggcgacatgctctcctgggac
gaactggcggaacggctgatcccctattgcgtcgacatgggcttcacccatatcgaattc
ctgccgatctccgaatttccctacgacccgtcctggggttaccagaccaccggtctttat
gcgccgacggcgcgcttcggcgaaccggagggctttgcccgcttcgtcaacggctgccac
aaggccggcatcggcgtcattctcgactgggtaccggcgcattttccgaccgacgagcat
gggcttcgctggttcgacggcacggcgctctacgagcatgaggatccgcgccagggcttc
catcccgattggaacacggcgatctacaatttcggccgtgaggaggtcgccgcctatctc
gtcaacaacgccctctattgggccgagaagttccatgtcgacggcctgcgcgtcgatgcg
gtcgcgtcgatgctctatctcgactattcgcgccagcacggcgaatgggtgccgaacgaa
tatggcggcaatgaaaatctcgaggcggtccgcttcctgcagacgatgaacagccgcctc
tacggcatccatcagggcgtcctgacgatcgccgaggagtcgacctcctggccgaaggtc
tcgcatccggttcataccggcgggctcggcttcggcttcaaatggaacatgggcttcatg
cacgacacgctgcaatatctgtcgcgcgagccggtgcaccgcaagttccaccacaacgac
atgaccttcgggctgctctacgccttcagcgagaatttcgtcctgccgctgtcgcatgac
gaggtcgtgcacggcaagggatcgctgatcgccaagatggccggcgacgattggcagaag
ttcgccaacctcagggcctactacgccttcatgtggggctatccgggcaagaagctgctg
ttcatggggcaggagttcgcccagtggcgcgaatggtcggaagagcgccagctcgactgg
aacctgcttgagtacaaccttcacgaaggcatgcggcggctggtccgcgacttgaacggc
acctaccgctcgaagccggcgctgcacgcgcgcgactgcgagggcgagggcttcgagtgg
ctgattgccgacgaccgggacaattcggtcttcgcatggctgagaaaggcgccgggcgag
aagctggtcgcggtcgtcaccaactacacgcccgtctaccgggagggctacgacgtgccg
ctgccggtggcgggacgctggaaggaaatcctcaacaccgatgcggagatctacggagga
agcggcaagggcaacggcggcgccgtgcaagcggaaaagaaatcgaacggaaggacgatg
gccaccgtcacgctgccgccgctggcgacgctgatgctggagcaggattga

DBGET integrated database retrieval system