KEGG   Rivularia sp. PCC 7116: Riv7116_5720Help
Entry
Riv7116_5720      CDS       T02364                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
riv  Rivularia sp. PCC 7116
Pathway
riv00860  Porphyrin and chlorophyll metabolism
riv01100  Metabolic pathways
riv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Riv7116_5720
Enzymes [BR:riv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Riv7116_5720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA ABC_tran DUF815 AAA_18 AAA_28 AAA_23 AAA_30 AAA_7 MMR_HSR1 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFY58086
UniProt: K9RKN6
Position
7209368..7210489
Genome map
AA seq 373 aa AA seqDB search
MSPTNQKTSTARRVVFPFTAIVGQEEMKLALILNVIDPKVGGVMIMGDRGTGKSTTIRAL
ADLLPEVSVVRDDPFNSHPSDPDVMGDEARQKLEQGEEIAVEQMKVPMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPALRVQIVEQRSEFDQNP
PEFLEKYQQQQQELQERIVKAQKLLPSVNMEYDYRVKISEVCSELDVDGLRGDIVSNRAA
KALTAFEGRNEVTVDDIRRVIALCLRHRLRKDPLESIDTGYKVEKTFSRVFGVELPEDTA
NVNGTSEKVGAKR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcctactaatcaaaagacttctacagcacgacgtgtggtatttccttttaccgcc
attgtaggtcaggaagaaatgaagctggctctgattctaaatgtgattgaccccaaagtt
ggcggtgtaatgataatgggagatcggggaaccggcaaatcaaccacgattcgagcgctt
gctgacttacttccagaggtttcagtagtcagggatgaccccttcaattctcatccgagc
gatcccgatgttatgggtgatgaagctcgtcaaaaactggaacaaggtgaagaaattgct
gtagaacaaatgaaggtgccaatggtagatttacctttgggagcgacagaagaccgagtt
tgtggcaccatcgatattgaaaaggctttatcggaaggtgttaaagcttttgaaccggga
cttttagctaaagcgaaccgaggcattctttacgttgatgaagtcaacttgctagatgac
catttagtagacgtattgctagactcagcagctagcggttggaacaccgtcgaacgtgaa
ggcatttccattcgccacccagcccgtttcgttttggttggctcaggaaacccagaagaa
ggtgaattacgaccccagttacttgatagatttggaatgcacgctgaaattcgtaccgtt
agagaaccagctttgagggtgcaaattgtagaacaaaggtcggaatttgaccaaaatccc
ccagaattcttggaaaagtatcaacagcagcagcaagaattgcaagagcgcatcgttaaa
gcccagaaacttttaccttccgttaatatggaatacgactaccgggtcaaaatttccgaa
gtatgttctgagctagacgtagacgggttgcggggtgatatcgttagtaatcgcgctgcc
aaagctttaactgcatttgaaggacgtaacgaagttacagtagacgacattcgccgcgtt
attgctttgtgtttgcgtcacagactgcggaaagaccccttagaatcaatcgataccggc
tacaaagtagagaaaaccttttcccgcgtctttggcgtagagcttccagaagacacagcc
aacgttaacggaacttctgagaaagtcggagcaaaaaggtag

DBGET integrated database retrieval system