KEGG   Roseobacter litoralis: RLO149_c005360Help
Entry
RLO149_c005360    CDS       T01572                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rli  Roseobacter litoralis
Pathway
rli00260  Glycine, serine and threonine metabolism
rli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rli01100  Metabolic pathways
rli01110  Biosynthesis of secondary metabolites
rli01130  Biosynthesis of antibiotics
rli01230  Biosynthesis of amino acids
Module
rli_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLO149_c005360 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RLO149_c005360 (trpA)
Enzymes [BR:rli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RLO149_c005360 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB NanE
Motif
Other DBs
NCBI-ProteinID: AEI92564
UniProt: F7ZJD2
Position
complement(562523..563314)
Genome map
AA seq 263 aa AA seqDB search
MTRIDEKFAQLAKDGKKAFVAYVMAGDPDYETSLEIVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQKTLNLARAFREDDQTTPIVMMGYYNPIYSRGVESFLAEAKD
AGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTDEKRLPRVLQNTSGFVYYVSIT
GITGAAEAQAVDVGPEVARIKSAAALPVIVGFGVNTPEKSKAIAEVADGVVVGSAIVGKI
GAGDSVSDVLTFVKTLSDGAHSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtattgacgaaaaattcgcccaacttgctaaagacggcaaaaaagcctttgtg
gcttacgtaatggctggcgatccggactatgagacgtcgttggaaatcgtcaaagggttg
cctgcggcgggtgtggatgtgatcgaactgggcctgcccttcaccgatccgatggcggac
gggccgacgatccaactggccggtcagcgcgcgcttgaagctggaatgacgctgcaaaag
acgctgaatctcgcccgcgcttttcgcgaagacgaccagacaacccccatcgtcatgatg
ggctactacaacccgatctacagccgcggcgtagagagctttctggccgaggccaaggac
gcaggcattgatggtctgatcgtggtggaccttccccccgaggaagacagcgaattgtgt
ctgcccgcgcaagccgctggtctgaatttcatccgcctcgcaacgcccaccaccgatgaa
aaacggctgccgcgtgttctgcaaaacacctccggttttgtctactacgtgtcgatcaca
ggcatcaccggcgctgccgaagcgcaagcggtcgatgtcggccccgaagtggcgcggatc
aaatccgccgccgccctgcccgttatcgtcggtttcggcgtgaacacccctgaaaaatcc
aaagccatcgcagaggtagccgacggcgtggtcgtgggatcagccattgtcggaaaaatc
ggcgcaggcgacagcgtttcggatgttctgaccttcgtcaaaactctgtctgacggcgcc
cacagcgtgtga

DBGET integrated database retrieval system