KEGG   Roseobacter litoralis: RLO149_c005360Help
Entry
RLO149_c005360    CDS       T01572                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rli  Roseobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RLO149_c005360 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RLO149_c005360 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RLO149_c005360 (trpA)
Enzymes [BR:rli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RLO149_c005360 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(562523..563314)
Genome map
AA seq 263 aa AA seqDB search
MTRIDEKFAQLAKDGKKAFVAYVMAGDPDYETSLEIVKGLPAAGVDVIELGLPFTDPMAD
GPTIQLAGQRALEAGMTLQKTLNLARAFREDDQTTPIVMMGYYNPIYSRGVESFLAEAKD
AGIDGLIVVDLPPEEDSELCLPAQAAGLNFIRLATPTTDEKRLPRVLQNTSGFVYYVSIT
GITGAAEAQAVDVGPEVARIKSAAALPVIVGFGVNTPEKSKAIAEVADGVVVGSAIVGKI
GAGDSVSDVLTFVKTLSDGAHSV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtattgacgaaaaattcgcccaacttgctaaagacggcaaaaaagcctttgtg
gcttacgtaatggctggcgatccggactatgagacgtcgttggaaatcgtcaaagggttg
cctgcggcgggtgtggatgtgatcgaactgggcctgcccttcaccgatccgatggcggac
gggccgacgatccaactggccggtcagcgcgcgcttgaagctggaatgacgctgcaaaag
acgctgaatctcgcccgcgcttttcgcgaagacgaccagacaacccccatcgtcatgatg
ggctactacaacccgatctacagccgcggcgtagagagctttctggccgaggccaaggac
gcaggcattgatggtctgatcgtggtggaccttccccccgaggaagacagcgaattgtgt
ctgcccgcgcaagccgctggtctgaatttcatccgcctcgcaacgcccaccaccgatgaa
aaacggctgccgcgtgttctgcaaaacacctccggttttgtctactacgtgtcgatcaca
ggcatcaccggcgctgccgaagcgcaagcggtcgatgtcggccccgaagtggcgcggatc
aaatccgccgccgccctgcccgttatcgtcggtttcggcgtgaacacccctgaaaaatcc
aaagccatcgcagaggtagccgacggcgtggtcgtgggatcagccattgtcggaaaaatc
ggcgcaggcgacagcgtttcggatgttctgaccttcgtcaaaactctgtctgacggcgcc
cacagcgtgtga

DBGET integrated database retrieval system