KEGG   Roseobacter litoralis: RLO149_c015580Help
Entry
RLO149_c015580    CDS       T01572                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rli  Roseobacter litoralis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RLO149_c015580 (glpK)
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RLO149_c015580 (glpK)
Exosome [BR:rli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RLO149_c015580 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1601073..1602560
Genome map
AA seq 495 aa AA seqDB search
MTHILAIDQGTTSSRAIIFDGAMNITASAQEEFTQHYPDSGWVEHDPGDLWATTAGTCRA
AIEKAGLKPEDIAAIGITNQRETVVVWDKTTGQPVYNAIVWQDRRTAAYCKTLRDEGHDK
MITARTGLLADPYFSATKLKWILDNVEGARDRAMRGELLFGTVDTFLIWKLTGGAAHVTD
ATNAARTSLYDIHKGRWSQTICALFDIPQQMLPEVKDCAADFGVTRSDLFGRPVLILGVA
GDQQAATIGQACFEPGMLKSTYGTGCFALLNTGDTAVASSNRLLTTIAYQFDGKPTYALE
GSIFVAGAVVQWLRDGLQTIRNASETQAMAERADPTQNVVLVPAFVGLGAPYWDAECRGA
VFGLTRNSGPDEFAKAALESVGYQTRDLLDAMTADWQGSGARATLRVDGGMSASDWAMQF
LSDIIDAPVDRPKVLETTALGAAWLAGQRAGLYPDQAGFAANWALEKTFEPQMNAEDRDQ
KYAAWKRAVDATLRF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacccatattctggccattgatcagggaaccacgtcgtcacgtgcgatcatttttgat
ggggcgatgaacatcaccgcatccgcacaggaagagttcacgcaacattatcccgacagc
ggctgggttgagcatgatcccggtgatttatgggcgacaacggcaggaacgtgtcgcgcg
gccatcgaaaaagcaggcctgaagcctgaggacatcgccgccatcgggatcacaaatcaa
cgcgaaacggtggtggtttgggataaaaccacaggccagcccgtttacaatgcgatcgtt
tggcaggaccggcgcacagcggcctattgcaagacgctgcgcgatgaaggtcatgacaag
atgatcacggcgcgcaccgggctgctggcggatccgtatttctcggcgaccaagctgaag
tggatattggacaatgtggaaggtgcaagggaccgcgcgatgcggggtgaattgctgttc
ggcacggttgatacctttctgatctggaaactaaccggcggggcggcgcatgtcacggac
gccacgaatgccgcgcgcacgtccctttatgacatccacaaaggacgctggagccagacg
atctgcgcgctgtttgatattccgcaacagatgttgcctgaagtgaaagactgcgccgcg
gactttggcgtgacgcgctctgatctgttcggcaggccggtgctgatcctcggcgttgcg
ggtgatcagcaggcggcgacaatcgggcaggcgtgttttgaaccgggcatgttgaaatcg
acctatggcacggggtgtttcgccttgctgaatacgggcgacacggcagtggcctccagc
aatcggctgctgactacgattgcctatcagtttgacggcaaaccgacctatgcgcttgag
gggtcgattttcgtcgccggggctgtggtacaatggctgcgtgatgggctgcaaaccatc
cgtaatgcgagcgaaacccaagcgatggcagagcgcgcagaccccacccagaatgtggtg
ctggtgcctgcttttgtgggcttgggcgcgccttattgggatgctgagtgtcggggtgcg
gtttttgggctgacgcgcaattccgggcctgatgaattcgccaaggccgcgctggaaagc
gtggggtaccaaacccgcgatctgttggatgcgatgacagccgattggcagggcagcggt
gcgcgcgcaacattgcgtgtggatgggggaatgtcggcctcggattgggcgatgcaattt
ttgtcagatatcatagatgcccctgtggaccggcccaaagtgcttgaaaccaccgcattg
ggggctgcttggctggcagggcagcgcgccggactttacccggatcaggccgggtttgcg
gcaaactgggcactggaaaagacctttgagcctcagatgaacgcggaggatcgtgatcaa
aaatacgcggcctggaaacgggcggtggacgccactttacggttttaa

DBGET integrated database retrieval system