KEGG   Roseobacter litoralis Och 149: RLO149_c015710Help
Entry
RLO149_c015710    CDS       T01572                                 

Gene name
bgaB
Definition
beta-galactosidase 1 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rli  Roseobacter litoralis Och 149
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rli00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621577..1623487)
Genome map
AA seq 636 aa AA seqDB search
MSAPLKRALGVCYYPEHWPEDMWAKDAARMVSAGITWVRIGEFAWSRMEPEPGRFTFDWL
DRAIDVLASAGLKIVLGTPTCTPPRWMLDRFPDMLAVDALGRTRNFGSRRHYCFSHAGYR
KASAAIADVLGRRYGQDPHIHAWQLDNEYGCHDTVLSYSEAARLAFQDWLATRYGTIDAL
NTAWGNVFWSMEYESFAQVDLPNLTVTEPNPSHALAFRRFSSDQVVAYHMAQVDALRAHT
DAPLIHNYMGRVLDFDHFEVGRSIEIASWDSYPIGFLSDRLEATPAHKSRYLQQGDPDMQ
AFHHDLYRAVGKNGRWWVMEQQPGPVNWAPHNPAPLPGMVRLWTWEAFAHGAEVVSYFRW
RQAPFAQEQMHSGLLRPDDAAAPGLAEAEAVATEISAMPEVSVQQAQVALIFDYPSEWAW
ATLPQGAGFTYFGLMLDAYRALRKRGLSVDILPSTTSDLSGYRLVLVPGLATLPDSLRHA
LGQTTALVGPRSNCVTEELTIPTPMGPGLPGLDVTVTRVESLSPGAHRTVPGIGVMQHWV
ETLEGSAQVTLQDADGAALVVSSGALSYLGGWPDAALWDHLIADAAARCGIETRQMPEGL
RCRETKTHRFYFNYGDAPCEFDGLTLPAAGVAWVAI
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgctgaaacgcgcccttggcgtctgctattaccctgaacactggcccgaa
gacatgtgggccaaagacgccgcacgcatggtatcggcaggcatcacatgggtccgcata
ggcgaattcgcatggagccggatggaaccggagccggggcgtttcacctttgactggctg
gaccgggcgatcgatgttttggccagtgctggcctgaaaatcgtgttgggcacaccgacc
tgtaccccgccacgctggatgctggatcggtttccggacatgctggccgtcgatgcactg
gggcgaacgcgcaatttcggctcacggcggcactattgctttagccatgcaggctatcgc
aaagcctccgccgcgattgctgatgttttgggacgaagatacggacaagatccgcacatt
cacgcatggcagttggataacgaatacggctgccacgacaccgttctgtcctattcggag
gccgcgcgcctcgcctttcaggactggctcgccacgcgctatggtacgatcgacgcgctg
aacaccgcttggggcaatgtgttctggtcgatggaatacgaaagttttgcgcaggtggat
ttgcccaacctgacggtcacagaacccaacccaagccacgcgctggcctttcgccgtttc
agttccgatcaggtggttgcctatcacatggcacaggtcgacgccctgcgcgcccatacc
gatgcgccgctgatccacaactacatgggccgggtgctggattttgaccatttcgaggtc
ggacgctcgattgaaatcgcaagttgggacagctatccgatcgggtttctctctgaccgg
ctggaggcgacgccggcgcataaatcccgctatttgcagcagggtgatccggatatgcag
gcctttcaccacgacctgtaccgggcggtcggcaagaacggccgctggtgggtgatggag
cagcagccggggcccgtcaactgggcaccgcacaaccctgccccgctgcccggcatggtc
cggctctggacgtgggaggcctttgcccatggggcagaagtggtcagttattttcgatgg
cgacaagccccgtttgcgcaggaacagatgcactctggactgctgcggcctgacgatgcg
gccgcccccgggctggccgaggcagaagccgtcgcaacagaaatcagcgcaatgcctgag
gtatctgtgcagcaagcgcaggtcgctctgatctttgattatccatcagaatgggcgtgg
gccacgctgccacaaggcgccgggttcacatattttggactgatgctcgatgcctatcgt
gcgctgcgcaagcgcgggttgtcggtcgatatcctgccgtccaccacatctgatctgtcc
gggtacaggctggtgctggtgcctggcctcgccacactgcccgacagtctgcgccatgcg
cttggccagacgaccgcccttgttgggccgcgcagcaattgcgttacagaagagctgacg
ataccgaccccaatgggccccggtctgccgggcctggatgtgaccgtgacacgggtggaa
agcctgtcacctggcgcgcaccgcaccgttccggggatcggtgttatgcagcattgggtt
gagaccttggaggggtctgcgcaggtaaccctgcaggatgcggatggggccgcattggtg
gtctcaagcggggcgctttcgtatctgggcggttggccggatgcagcgctctgggatcat
ctgatcgccgatgccgccgcccgctgcgggatagaaacacggcaaatgcccgaaggcctg
cgctgccgagagaccaaaacgcaccgtttctatttcaactacggcgatgcaccctgtgag
tttgatggcctgaccctgcccgccgctggtgtggcttgggttgcgatttag

DBGET integrated database retrieval system