KEGG   Roseobacter litoralis: RLO149_c042230Help
Entry
RLO149_c042230    CDS       T01572                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rli  Roseobacter litoralis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RLO149_c042230 (gtaB)
   00052 Galactose metabolism
    RLO149_c042230 (gtaB)
   00500 Starch and sucrose metabolism
    RLO149_c042230 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    RLO149_c042230 (gtaB)
Enzymes [BR:rli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RLO149_c042230 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4273749..4274642
Genome map
AA seq 297 aa AA seqDB search
MTRKVTKAIFPVAGMGTRFLPATKSVPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSR
GKGALEDYFDHAPQLEQSLRDKGKTELLEMLENTNMESGAIAYIRQHKALGLGHAVWCAR
RLIADEPFAVILPDDVIAGDKPCLQQMVEAYEETGGNMVAAMEVPPEKASSYGMLDIETD
MGSMVRVKGMVEKPPAGKAPSNLAVIGRYILAPAVLTNLNDMKKGAGGEVQLTDAIATEI
NKESGVYGYRFQGQRFDCGSKSGFLQATVSFGLARDDLRDDLSEYIHDIVSMSKAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaaagtaacgaaagcaatttttcctgttgcaggaatgggcacgcggttcttg
cccgcgacaaaatctgtcccgaaggagatcatgacgctcgttgatcgaccgctgattcaa
tacgcaatcgacgaagcgcgcgccgccgggatcaaggaattcatctttgtgacgtctcgc
ggcaaaggtgcgctggaagactatttcgaccatgcgccgcagctcgagcaatcgttgcgt
gacaaaggcaagacagagctgttggaaatgctcgaaaacaccaatatggaaagcggtgca
attgcctatatcagacaacacaaagcgctggggctgggtcacgccgtttggtgcgcgcgc
cgcctgattgccgatgaacctttcgcggttatcttgccggacgatgtcattgccggtgac
aaaccgtgcctgcagcagatggttgaggcatatgaggaaacgggcggcaatatggtcgcc
gcgatggaagtgcctccggaaaaagcatcatcttacggcatgttggatatcgaaacggac
atggggtcgatggtgcgcgtcaaaggcatggttgagaaaccaccagccggtaaagcgccg
tctaaccttgccgtcataggtcgctatattctggcccctgcggttttgacaaacctcaac
gacatgaaaaaaggtgccggcggtgaggtccaactgacggacgcgatcgcgaccgagatc
aacaaggaaagcggtgtctatgggtaccggttccagggtcaaagattcgattgtggctca
aagtcgggctttttacaggcgaccgtttcattcggcctggcccgtgacgaccttcgggat
gatctgtcagaatacatccatgatatcgtcagcatgagtaaggcagcgcagtag

DBGET integrated database retrieval system