KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_3691Help
Entry
Rleg2_3691        CDS       T00779                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_3691
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rleg2_3691
   00650 Butanoate metabolism
    Rleg2_3691
  Energy metabolism
   00190 Oxidative phosphorylation
    Rleg2_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3821782..3822162)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKDGTDHFWRQRLTAVANVPLILFFLFFMITYAGAPYADVVRALS
NPFVAVVMGLMVISGVIHMKLGMQVIIEDYVHGEFGKIALLMLNTFFAILIAGLCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgcacccccctcggcaaggttcgcgggctcggctccgccaaggacggcacg
gaccatttctggcgccagcgtctgacggccgtcgccaatgttccgctcatccttttcttt
ctcttcttcatgatcacctatgccggcgcaccctatgcggatgtggtccgcgccctgtcg
aacccgttcgttgccgtggtcatggggctgatggtgatttcaggcgtcatccacatgaag
ctcggcatgcaggtgatcatcgaggattacgtgcacggcgaattcggcaagatcgctctc
ttaatgctgaacaccttctttgcgatcctgatcgccggcctctgtctcttcgccattctg
aaaatcgcattcgtaggataa

DBGET integrated database retrieval system