KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0852Help
Entry
Rhom172_0852      CDS       T01606                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rhom172_0852
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rhom172_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(972164..974152)
Genome map
AA seq 662 aa AA seqDB search
MKRHTLRGLTGLALAALLIGLIGCRGGGQTGAVVSEDPVEIARARGLSPADVVAAVKTYQ
PTGTYDEYIMFASGGHSGQVLVIGIPSMRLLKVIGVFTPEPWQGWGFSKETREVLAQGNY
DGKELTWGDVHHPALSETNGDYDGQFLFVNEKANARVAVIDLRDFETKQIVKNPLSLSDH
GGTFVTPNTEWVIEGGQYAAPFEGYASLDQYKEKYRGLVTFWKFDRERGRILPEQSFALE
LPPYWQDLCDAGKQVSEGWVFCNSFNTEMATGGVEKGNPPFEAGASQRDMDYLHVINLRK
AAELVEAGRTRTIKGFKVLPLDVAAAEGVLYFIPEPKSPHGVDVSPDGNYLVVSGKLDPH
ATIYNFQKIQDAIANERFSGRDDYGVPILDFDAVVEAQVELGLGPLHTQFDPNGYAYTSL
FLESAVVRWTLGGPWAEKHGRDPWTVVDKVSVHYNIGHLAVAEGDNVNPDGRYLVAMNKW
SVDRFANVGPLLPQNFQLIDIGNPNGPMQLLYDMPIALGEPHYAQIIKADKLHPWEVYPE
VGWDPTTQSRHPAATRPGEERIERRGNTVEIWMTATRSHFTPEHVEVRKGDRVIWHITNI
ERARDATHGFALPGYNFNLSIEPGETATIEFVADRDGVFAFYCTEFCSALHLEMAGYFLV
RP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccacacgttacgcgggctgaccggtctggcgctggccgccctgctgatcggc
ttgatcggttgtcggggcggcggacagacaggcgccgtggtcagcgaagaccccgtggag
atcgcgcgggcgcgtggactgagcccggccgatgtggtggccgcggtaaagacctaccag
cccaccggcacctacgacgagtacatcatgttcgcctcgggcgggcactccggacaggtg
ctcgtcatcggcattccctcgatgcgcctgctgaaggtgatcggcgtcttcacgccggag
ccctggcagggctggggcttctcgaaggaaacccgggaagtcctcgcccagggcaactat
gatggcaaggagttgacctggggtgacgtgcaccacccggccctctccgagacgaacggc
gactacgacgggcaattcctgttcgtcaacgaaaaggccaacgcgcgcgtggccgtcatc
gacctgcgggacttcgagacgaagcagatcgtcaagaacccgctctcgctgagcgaccac
ggcggcacgttcgtcacgcccaacacggagtgggtgatcgaaggcggccagtatgccgcc
ccgttcgagggctacgcctcgctggatcagtataaagagaagtatcgcgggctggtcacc
ttctggaagttcgaccgcgagcgggggcggatccttcccgagcagtccttcgcgctggag
ctgccgccctactggcaggacctgtgcgacgccggcaagcaggtgagcgaagggtgggtc
ttctgcaactcgttcaacacggaaatggccacgggtggcgtggagaaaggcaacccgccc
ttcgaggccggcgcctcgcagcgcgacatggactacctgcacgtgatcaacctgcgcaag
gcggctgagctggtcgaggccggtcgcacgcgcacgatcaagggcttcaaggtcctgccg
ctggacgtggccgccgccgaaggcgtgctctacttcatccccgaacccaagagcccgcac
ggcgtcgacgtttcgccggacggcaactacctggtcgtctccggcaagctcgatccgcac
gccaccatctacaacttccagaagatccaggacgccatcgccaacgagcgcttctcgggg
cgtgacgactacggtgtgccgatcctggacttcgacgcggtggtcgaagcgcaggtagag
ctggggctcggaccgctgcacacgcagttcgacccgaacggctacgcctacacgagcctt
ttcctggaaagcgccgtggtgcgctggacgctgggcggtccctgggccgaaaagcacggc
cgggatccatggaccgtggtcgacaaggtgtcggtccactacaacatcgggcacctggcc
gtggccgaaggcgacaacgtgaaccccgacggccgctacctggtggccatgaacaagtgg
tccgtggaccgtttcgcgaacgtggggccgctgttgccgcagaactttcagctcatcgac
atcggcaacccgaacggcccgatgcagctcctctacgacatgcccattgcactgggtgag
ccgcactatgcccagatcatcaaggcggacaagctccacccgtgggaggtctatccggaa
gtcggctgggatccgaccacccagtcgcggcatccggcggccacccgtcccggggaggag
cgcatcgagcgccggggcaacacggtggagatctggatgacggccacacgcagccacttc
acgccggagcatgtggaggtccggaagggcgaccgcgtgatctggcacattacgaacatc
gaacgggcgcgggacgccacgcacggcttcgcgctgcccggctacaacttcaacctgagc
atcgagccgggcgagacagccaccatcgagttcgtggccgatcgcgacggcgtcttcgcc
ttctactgcaccgagttctgctcggccctccacctggagatggccggttacttcctagtg
cgtccgtaa

DBGET integrated database retrieval system