KEGG   Rothia mucilaginosa: RMDY18_05550Help
Entry
RMDY18_05550      CDS       T01144                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rmu  Rothia mucilaginosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RMDY18_05550
   00052 Galactose metabolism
    RMDY18_05550
   00500 Starch and sucrose metabolism
    RMDY18_05550
   00520 Amino sugar and nucleotide sugar metabolism
    RMDY18_05550
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RMDY18_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576105..577013
Genome map
AA seq 302 aa AA seqDB search
MATEIKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRPAIQYVVEEAIRAGLNDVLMI
TGRNKRALEDHFDRVPVLEQQLAEQGKDALLASVVATNEMGGDLHYVRQGDPKGLGHAVL
RAKRHVGDEAFAVLLGDDLIDEKEDLLSRMVEVQERTGGSVVALMEVPREAISAYGAAAI
EAVEGEDGFVKITGLVEKPAADEAPSNYAVIGRYVLSPKVFEVLENTAPGRGGEIQLTDA
LQTLAQGEGEGEGVYGVVFSGRRFDTGDKLSYLKANVILAAERPEFGDDLRAWLKDFVAE
NC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaattaagtctgttactaaggcagttattcctgctgctggtctgggcacc
cgattcctgcccgccacgaaggcaacccccaaggaaatgctccccgtcgttgatcgcccc
gcgattcagtacgtggtggaggaagcaatccgtgccggtctgaatgacgttctgatgatt
accggccgtaacaagcgcgctctcgaggatcacttcgaccgcgttcccgttctggagcag
cagctcgctgagcagggtaaggacgctctgctcgcttctgtggtagctaccaatgagatg
ggcggcgacctgcactacgtgcgtcagggcgaccccaagggcctgggccacgctgttctg
cgcgcaaagcgccacgttggcgatgaggcattcgctgttctgctcggtgatgacctgatt
gatgagaaggaagacctgctctcccgcatggtggaggtccaggagcgcaccggcggttcc
gtcgttgctctgatggaggtcccccgcgaggctatttccgcttacggtgcagctgctatt
gaggctgttgagggcgaagacggtttcgtgaagatcaccggtctggttgagaagcccgct
gctgatgaggctccctcgaactacgctgtgatcggccgttacgttctgagcccgaaggtc
ttcgaggttctggagaacaccgctccgggccgcggcggcgagattcagctgactgacgct
ctgcagaccctggctcagggtgagggcgaaggcgaaggcgtctacggtgtggtcttctcc
ggccgccgtttcgacaccggtgacaagctgtcctacctgaaggcaaacgttattcttgct
gctgagcgtcccgagttcggtgacgacctgcgcgcatggctgaaggactttgtcgcagag
aactgctaa

DBGET integrated database retrieval system