KEGG   Rothia mucilaginosa: RMDY18_05550Help
Entry
RMDY18_05550      CDS       T01144                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rmu  Rothia mucilaginosa
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RMDY18_05550
   00052 Galactose metabolism
    RMDY18_05550
   00500 Starch and sucrose metabolism
    RMDY18_05550
   00520 Amino sugar and nucleotide sugar metabolism
    RMDY18_05550
Enzymes [BR:rmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RMDY18_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576105..577013
Genome map
AA seq 302 aa AA seqDB search
MATEIKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRPAIQYVVEEAIRAGLNDVLMI
TGRNKRALEDHFDRVPVLEQQLAEQGKDALLASVVATNEMGGDLHYVRQGDPKGLGHAVL
RAKRHVGDEAFAVLLGDDLIDEKEDLLSRMVEVQERTGGSVVALMEVPREAISAYGAAAI
EAVEGEDGFVKITGLVEKPAADEAPSNYAVIGRYVLSPKVFEVLENTAPGRGGEIQLTDA
LQTLAQGEGEGEGVYGVVFSGRRFDTGDKLSYLKANVILAAERPEFGDDLRAWLKDFVAE
NC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaattaagtctgttactaaggcagttattcctgctgctggtctgggcacc
cgattcctgcccgccacgaaggcaacccccaaggaaatgctccccgtcgttgatcgcccc
gcgattcagtacgtggtggaggaagcaatccgtgccggtctgaatgacgttctgatgatt
accggccgtaacaagcgcgctctcgaggatcacttcgaccgcgttcccgttctggagcag
cagctcgctgagcagggtaaggacgctctgctcgcttctgtggtagctaccaatgagatg
ggcggcgacctgcactacgtgcgtcagggcgaccccaagggcctgggccacgctgttctg
cgcgcaaagcgccacgttggcgatgaggcattcgctgttctgctcggtgatgacctgatt
gatgagaaggaagacctgctctcccgcatggtggaggtccaggagcgcaccggcggttcc
gtcgttgctctgatggaggtcccccgcgaggctatttccgcttacggtgcagctgctatt
gaggctgttgagggcgaagacggtttcgtgaagatcaccggtctggttgagaagcccgct
gctgatgaggctccctcgaactacgctgtgatcggccgttacgttctgagcccgaaggtc
ttcgaggttctggagaacaccgctccgggccgcggcggcgagattcagctgactgacgct
ctgcagaccctggctcagggtgagggcgaaggcgaaggcgtctacggtgtggtcttctcc
ggccgccgtttcgacaccggtgacaagctgtcctacctgaaggcaaacgttattcttgct
gctgagcgtcccgagttcggtgacgacctgcgcgcatggctgaaggactttgtcgcagag
aactgctaa

DBGET integrated database retrieval system