KEGG   Rattus norvegicus (rat): 114633Help
Entry
114633            CDS       T01003                                 

Gene name
Plce1, Plce
Definition
phospholipase C, epsilon 1 (EC:3.1.4.11)
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    114633 (Plce1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    114633 (Plce1)
   04015 Rap1 signaling pathway
    114633 (Plce1)
   04020 Calcium signaling pathway
    114633 (Plce1)
   04070 Phosphatidylinositol signaling system
    114633 (Plce1)
   04024 cAMP signaling pathway
    114633 (Plce1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    114633 (Plce1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    114633 (Plce1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     114633 (Plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q53
AA seq 2281 aa AA seqDB search
MTSEEMAASFLIPVPQRKVASAQSVAEERGEKVSEAGIPKTRAGRQGGLTPRTISQRNEP
EEESPRTDFSQVFSIARGELDSDENHNERCWEENVPGSTKNHAVNCNSLLQSHQHALPPS
QLCEVCDSVTEEHLCLQPGIPSPLERKVFPGIELEMEDSPMDVSPLGNQPGIMESSGPHS
DRNMAVFHFHYAGDRTMPGAFHTLSEKFILDDCANCVTLPGGQQNKNYMAYTCKLVELTR
TCGSKNGQLKCDHCTSLRDEYLCFESSCRKAEALSSGGGFCEDGFTHGPSAKTFLNPLEE
FSDNCEDVDDIFKGKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLAAWSY
VDQKKAGLMWPCGNGMRPLSTVDVRQSGRQRLSEAQWCLIYSAVRREETEDTVGSLLHCS
TQLPTPDTAHGRIGDGPCLKQCVRDSECEYRATLQRTSIAQYITGSLLEATTSLGARSSL
LSSFGGSTGRIMLKERQPGTSMANSSPVPSSSAGISKELIDLQPLIQFPEEVASILTEQE
QNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKACISESILMSQSGEHNALEDLVMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGL
LKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNPEKELTVNSIFQIIRSCSRSLET
EDEESASEGSGSRKNSLKDKTRWQFIIGDLLDSDNDIFEKSKECDPHGSEESQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASPAG
ARLKLGVLSNVAEPGKFPSLGNAGVSGLVEGILDLFSVKAVYMGHPGIDIHTVCVQNKLS
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTTAVRKIRKFPDQRQQWL
RKQYVSFYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKNAEKPNMQRNNTLGIST
TKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQEANEQEDSEANVITNPPNP
LHSRRAYSLTTAGSPNLATGMSSPISAWSSSSWHGRIKGGMKGFQSFMVSDSNMSFIEFV
ELFKSFSIRSRKDLKDIFDIYSVPCNRSASESTPLYTNLTIEENTNDLQPDLDLLTRNVS
DLGLFMKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGE
HCTYDEILSIIQKFEPNISMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKDLQLPLS
YYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTK
IPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFETDF
SDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQTQAFTGGNANPPPASN
EEEEDEEDEYDYDYESLSDDNILEDRPENKSCADKLQFEYNEEVPKRIKKADNSSGNKGK
VYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNSSGSGRGKERKSRKS
IFGNNPGRMSPGETASFNRTSGKSSCEGIRQIWEEPPLSPNTSLSAIIRTPKCYHISSLN
ENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDL
PLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDAMDPATYSLTIISGQNV
CPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVV
ENNSSAITAQRIIPLKALKRGYRHLQLRNLHNEILEISSLFINSRRMEDNPSGSTRPASL
MFNTEERKCSQTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQILAVDQDTKLTAADYFL
MEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGRIVLKPQQETLEEKNI
VHDDREVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILNN
PNPCDYVLLEEVMKDAPNKKSSTPKSSQRILLDQECVFQAQSKWKGAGKFILKLKEQVQA
SREDKRRGISFASELKKLTKSTKQTRGLTSPPQLVASESVQSKEEKPMGALASGDTAGYQ
S
NT seq 6846 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgaagaaatggccgcttccttcctcatcccggtgcctcaaaggaaagtggct
tctgcccagtcagtggcagaggagcggggtgaaaaggtctcagaagccggcattcctaag
acacgagctggcagacagggtgggctcacccctcgtaccatctcacagcggaacgaacct
gaggaagagtctcctagaactgatttttcccaggtcttctcaatagcgaggggggaacta
gacagcgacgagaatcacaatgaaaggtgctgggaggaaaatgtgccaggttccacgaaa
aaccacgcggttaactgcaacagcttattgcaaagccaccagcatgcgcttcccccgagc
cagctctgtgaagtctgtgactctgtcacagaagaacacctgtgtttgcagcctgggatt
ccttctccactggaaaggaaggtgtttcctgggatcgaactggagatggaggactctccc
atggacgtgagccctttgggaaaccagcctgggatcatggagtccagcggacctcactct
gaccgcaacatggcggtatttcatttccattatgcaggtgacaggacaatgccaggtgct
ttccataccctgtcagaaaaattcattttggatgactgtgcaaactgtgttactcttcct
ggggggcagcaaaacaaaaattacatggcgtatacttgcaaactggtggagttgacaaga
acctgtggtagtaagaatgggcagctgaagtgtgaccactgcacctcgctgcgggatgaa
tacctgtgctttgaaagctcctgccggaaggctgaggctctctcctcaggtggtggcttt
tgcgaggacggatttactcatggtccctctgccaagacttttctgaaccctttggaggaa
ttctctgataattgtgaagacgtggacgatatttttaaaggcaaaaaggagcggtccact
ttgttagtccgaaggttttgtaaaaatgacagggaagttaagaagtctgtgtatactggg
acaagggccattgtgagaaccctgccttctggccacattgggctggctgcttggagttac
gtcgatcagaagaaagctggtctcatgtggccttgtgggaatggaatgagacctctgtcc
acagtggacgtaaggcaaagtgggagacagcgtctgtctgaagcccagtggtgtctgatc
tacagtgccgtgagaagagaagagacagaagatacggttggctctcttctgcattgctcc
acacagctcccaacccctgacacagcccatggaaggatcggagatggtccctgcctaaag
caatgtgtgcgagacagcgagtgtgagtaccgtgccaccctccaaaggacgtccatagct
cagtacatcaccggttctctcctagaggcaaccacatctttaggagcaagaagcagcctt
ctcagttcctttggaggatccactgggcgaataatgctgaaagaacgccaaccgggcact
tctatggccaattccagtcctgttccttcaagttcagctggaatcagcaaggagctgatt
gatctccagcccctcattcagttcccggaggaagtagccagcatcttaacagaacaggaa
cagaacatttaccgcagggtcctgcccatggactacctctgtttcttaacccgggacttg
agttcccccgagtgtcagagatcactgccccgtctcaaagcatgcatctcagaatcaatc
ctcatgtctcaaagtggagagcacaatgcccttgaagacctcgtgatgagatttaacgag
gtgagctcctgggtaacatggctgatcctcacggcaggctccatggaggagaagcgggaa
gtcttttcttatttggtgcatgtggccaaatgctgctggaacatgggcaactacaatgct
gtcatggagttcctggctggcctcaggtcaaggaaagttctgaagatgtggcagttcatg
gaccagtctgacatcgagaccatgaggagcctgaaagacgccatggctcagcatgagtct
tccgtggagtacaagaaggtagtgacccgagccttgcacatccccggctgcaaagtggtt
cccttctgtggggtgttcctgaaggagctctgtgaggtgcttgatggtgcctctggcctc
ctgaagctctgcccacgatacagctcccaagaagaagccctggagtttgtagcggattac
agtggacaagataacttcttacagcgagtggggcagaatggcttgaagaatccagagaag
gagctcacggtcaacagcatctttcagatcatccggagctgcagccgaagcttggagacg
gaggacgaggagagcgccagcgaagggagcggctctaggaaaaactccctcaaggacaaa
acccggtggcagtttataattggagatttgctggattcagacaatgacatctttgagaag
tccaaagagtgcgaccctcatggatcagaggagtcacagaaagcctttgaccatgggaca
gagctcatcccatggtatgtgctgtccatccaagcggatgtgcaccagttcctcctgcag
ggggccacagtcatccactatgaccaggacacacatctctccgcccgctgctttctccag
ttgcagcctgacaatagtaccttgacctggatgaaacctcccactgcctccccagctggt
gccagactcaagctcggtgtgcttagtaacgtggccgaacctggcaagttcccatcactg
ggcaacgctggggtgagcggcctggtagagggaatcctggatctgttttcagtgaaggct
gtgtacatgggacaccctggcattgatatacacactgtgtgtgtccagaacaaacttagt
agcatgcttctgtcagagactggggtgacgctgctctatgggcttcagaccaccgacaat
agattactgcacttcgtggcaccaaagcacacagctaaaatgcttttcagtggattgctg
gaactcactacagctgtgagaaagatacggaagttccctgaccaaagacaacagtggctt
cggaaacagtatgtcagcttctatcaggaggatggtcggtatgaaggcccaaccttggca
catgctgtggagttgtttggtggtaggagatggagcactagaaaccccagccctgggatg
tcagcaaagaatgccgagaagcccaacatgcagagaaacaacaccctaggcataagcacc
accaagaaaaagaagaaaatgctcatgaggggggagagtggagaggtgacggacgatgag
atggccacccgcaaggccaaaatgtacagagagtgtcgcagccggagcggctctgatcct
caagaggctaatgaacaggaagactcagaggccaatgtcatcactaaccctcccaacccc
ctccattccagaagagcctactcattgaccacggctgggtcccccaacttggctaccggg
atgtcatctcctatcagtgcctggagtagcagcagctggcatgggcggatcaaaggagga
atgaaaggcttccagagcttcatggtctcagacagtaacatgagtttcattgaattcgtc
gagctgttcaaatcattcagcataaggagccgcaaggacttgaaggacatctttgacatc
tactctgtaccctgtaatcggtctgcttctgagtcaaccccactgtacaccaacctgaca
atcgaagaaaataccaatgaccttcagcctgacctagatttgctgactagaaacgtctcc
gacttggggctgttcatgaagagtaagcagcagctttctgacaaccagaggcagatatct
gacgccattgctgctgcaagcattgtgactaatggcactgggattgaaagcacgtccctg
ggcatatttggggtcggcatactccagctcaacgacttcctggtgaattgccaaggagaa
cactgcacatatgatgaaatcctcagcatcatccagaagttcgagcccaacatcagcatg
tgtcatcaaggtctattgtccttcgaagggtttgcaaggtttctgatggataaagacaat
ttcgcctcaaaaaatgacgagtcgcgggagaacaagaaagacctgcagctacccctctcc
tactattacatcgaatcttcgcacaacacctacctcaccggccatcagctcaagggggag
tcctctgtggagctctacagccaggtcctcttgcaaggatgcagaagcatagagctggac
tgctgggatggagatgatgggatgcccattatttatcatggacatacgctgacaaccaag
atccccttcaaggaagtggtggaagccatcgatcgcagtgccttcatcacctccgacctg
ccaatcatcatatccattgagaaccattgctcattgcctcagcaacggaaaatggcagaa
attttcaagagtgtgtttggagaaaagctggtggctaagttcttgttcgagaccgatttc
tcagatgacccaatgcttccctcacctgaccaacttagaaggaaagtgcttcttaaaaac
aagaagctaaaggcccatcagacacctgtcgacatcctcaaacaaaaggctcatcagtta
gcatccatgcaaacacaggctttcactggtgggaatgccaacccgccacctgccagtaat
gaggaagaggaagacgaggaggacgaatatgattatgattacgagtccctgtctgatgac
aacattctggaagacagacctgagaacaaatcatgtgccgacaagcttcagtttgagtac
aatgaagaagtccccaagaggataaagaaagcagacaactcctccggcaataagggaaag
gtctatgacatggaactgggagaggagttttaccttcctcagaacaaaaaagaaagcagg
cagattgcaccggagctctctgacctcgtcatctattgccaggcggtaaaatttccaggc
ctgtcaactctaaattcatctggctctggcagagggaaagaaaggaaaagcaggaagtcc
atttttggcaacaatcccggcagaatgagcccaggggagacagcgtcatttaacagaaca
tctggaaaaagttcttgtgaaggaattcgacaaatctgggaggaacctccactcagccca
aacacatccctcagcgccatcattagaactcctaaatgctatcatatctcgtcactgaat
gaaaatgccgccaaacgtctgtgtcgcaggtattctcagaaactgatccagcacactgct
tgccagctgctgaggacctacccggcagcgaccagaatcgactcatccaatcccaacccc
ctcatgttctggctccatgggatacagcttgtagctctaaactaccagacggatgacctt
cctttacatttaaacgctgccatgtttgaggcgaatggtgggtgtggctatgttttgaag
ccccctgtcctgtgggataaaagctgtcccatgtatcagaagttttcaccactggaaaga
gacctggacgccatggatcctgctacctattctttaaccatcatctctggccagaatgtg
tgtcctagtaacagcaccggaagtccgtgcattgaagttgacgtcttgggcatgcccctg
gacagctgccatttccgcacaaaacccatccaccgaaacactctgaaccccatgtggaat
gagcagtttctcttccgggttcactttgaagatcttgtatttcttcgttttgcagttgtg
gagaacaacagttcggcgataacggctcagagaatcattccactcaaagctttaaagaga
ggatatcggcatcttcagctgcggaacctccacaacgagatcttggaaatctctagctta
ttcataaacagcaggaggatggaagataatccctctggcagtacccggccagcctctttg
atgttcaatactgaagagaggaaatgttctcagactcacaaagtcacagtgcatggtgtc
ccaggtccagagccctttgctgttttcacaataaacgaaggcaccaaggcaaagcagctt
ctccaacagattttggcagttgaccaggacaccaaacttacagccgcagactattttctg
atggaagagaagcattttatatctaaggaaaagaatgaatgcaggaaacaaccattccag
agagctgtgggcccagaggaagatattgtgcagattttaaacagctggttcccagaagaa
ggctacgtaggcaggattgtcttaaagccccaacaagaaaccctagaagagaaaaacatt
gtccacgatgacagagaggtgatcttgagctcagaagaggagagtttctttgtccaagtg
cacgatgtctctccagagcagcctcgaactgtcatcaaagccccacgtgtcagcactgca
caggatgtgattcagcagaccttgtgcaaagccaaatattcctacagcatcctgaacaac
cccaatccgtgtgactatgtgcttttggaagaggtaatgaaagatgcacccaataagaag
tcttctaccccgaagtcctcacagaggatcctcttggaccaagaatgtgtgtttcaagcc
caaagcaagtggaagggtgcagggaaattcatccttaagctaaaggagcaggtgcaggca
tccagagaagataaaaggaggggcatctcctttgcaagtgaactcaagaaactcacgaag
tccactaagcaaacccgaggactcacctcgcctcctcagcttgtggcctcagaaagtgtg
caaagcaaggaggagaaacccatgggtgccttggcctctggtgacacagcgggctaccag
tcgtga

DBGET integrated database retrieval system