KEGG   Rattus norvegicus (rat): 116719Help
Entry
116719            CDS       T01003                                 

Gene name
Acacb, Acc2
Definition
acetyl-CoA carboxylase beta (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    116719 (Acacb)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    116719 (Acacb)
   00640 Propanoate metabolism
    116719 (Acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    116719 (Acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    116719 (Acacb)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    116719 (Acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    116719 (Acacb)
   04920 Adipocytokine signaling pathway
    116719 (Acacb)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     116719 (Acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     116719 (Acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q16
AA seq 2456 aa AA seqDB search
MVLLLFLTYLVFSCLTISWLKIWGKMTDSRPLSNSKVDASLLPSKEESFASDQSEEHGDC
SCPLTTPDQEELASHGGPVDASQQRNSVPTSHQKPPRNPLSSNDTCSSPELQTNGVAAPG
SEVPEANGLPFPARPQTQRTGSPTREDKKQAPIKRQLMTSFILGSLDDNSSDEDPSSNSF
QTSSRKGSRDSLGTCSQEAALNTADPESHTPTMRPSMSGLHLVKRGREHKKLDLHRDFTV
ASPAEFVTRFGGNRVIETVLIANNGIAAVKWMRSIRRWAYEMFRNERAIRFVVMVTPEDL
KANAEYYKMADPVLPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPELL
CKHGIAFLGPRVRPMLGLGDRLSSTIVAQTLQIPTLPWSGSGLTVEWTEDSQHQGKCISV
TEDVYEQGCVRDVDEGLQAAEKVGFPLMIKASEGGGGKGIRQAESAEDFPCFFRQVQSEI
PGSPIFLMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPANIAAPAVF
EFMEQCAVLLAKTVVYVSAGTVGYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQ
LQIAMGVPLHRLKDIRLLYGESPWGVTPVSFETPLSPPIARGHVIAARITSENPDEAFKP
SSGTVQELNFRSNKNVWGYFSVAAAGGLHEFPISQFGHCFSWGENQEEAISNMVVALKEL
SIRGDFRTTVEYLVNLLETESLQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVFGALNVAD
AMFRTCITEFLHSLERGQVLPADSLLNIVDVELIYGGIKYVLKVARQSLTMFVLIMNGCH
IEIDAHRPNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGK
LMQYTVEDGQHVEVGSSYAEMEVMKMIMTLNVQESGRVNYIKRPGAVLEAGCVVAKLELD
DPSKVHAAQPFTGELPAQQTLPILGERLHQVFHSVLENLTNVMNGYCLPEPFFSMKLKDW
VEKPMMTLRHPSLPLLELQEIMTSVADRIPVPVEKAVRRVFAQDASNITSVLCQFPSQQI
ATILDCHAATLQRKVDREAFFMNTQSIVQLIQRYRSGTRGIMKAVVLDLLRRYLNVEHHF
QQAHYDKCVINLREQFKADMTRVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSEELTS
ILKELTQLSRSEHCKVALRARQVLIASHLPSYELRHNQVESSSCQPLTCNGHQFCPENLK
KLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEFQ
FMLPSSHPNRMAMPINVSDPDLLRHSKELFMDSGFSPLCHQRMGAMVAFRRFEEFTRNFD
EVISCFANVPTDTPLFSKACTSLYSEEDSKSLQEEPIHILNVAIQCADHMEDERLVPVFR
AFVQSKKHILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPGLAFQLELS
RMRNFDLTAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQN
EGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVAHVIMDPLKIEESVRAMVMRYGSRLW
KLRVLQAQVKINIRQTTSDCAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSFGNK
QGSLHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGSPEKYGPDIL
TYTELVLDSQGQLVEMNRLPGCNEVGMVVFKMRFKTPEYPEGRDTIVIGNDITFQIGSFG
IGEDFLYLRASEMARTEGIPQIYLAANSGAVLGLSEEIKQIFQVAWVDPEDPYKGFRYLY
LYLTPQDYTQISSQNSVHCKHIEDEGESGIIVDVIGKDSSLGVENLRGSGMIAGEASLAY
EKNVTISMVDCRAIGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGG
VQIMHTNGVSHVTVPDDFEGVCTILEWLSYIPKDNQSPVPIITPSDPIDREIEFTPTKAP
YDPRWLLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWDQTVVTGRARLGGIPVGVIAVETR
SVEVAVPAHPANLDSEAKIIQQAGQVWFPDSAFKTAQVIRDFNQEHLLLMIFANWRGFSG
GMKDMSEQMLKFGAYIVDSLRLSKQPVLIYIPPGAELRGGSWVVLDSSINPLCIEMYADK
ESRGGVLEPEGTVEIKFRKKDLVKTIRRIDPVCKKLLEPAGDTQLPDKDRKELESQLKAR
EDLLLPIYHQVAVQFADLHDTPGHMLKKGIISDVLEWKTTRTYFYWRLRRLLLEAQVKQE
ILRASPELSHEHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWSARDNLRSTIREN
LNYLKRDSVLKTIQSLVQEHPEATMGLCGYLSQHLTPAEQMQVVQLLSTTESPASH
NT seq 7371 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctctttctgacttacctggttttctcctgcctgaccatttcctggtta
aaaatctgggggaagatgacagactcgaggccgctcagcaacagtaaggtggatgcaagc
ctccttccgagcaaggaggagtcttttgcctcggaccagtcagaggagcatggcgactgc
agctgtccgttgacaactcctgaccaggaggagctggcctcccacggaggtcctgtagat
gccagtcagcagaggaactctgtaccaacctcacaccagaagcctccgaggaacccacta
tcttccaatgacacctgttcctccccagaactccaaaccaacggggtagcagcacctggc
tcagaggttccagaagccaacgggttgcctttcccagccaggcctcagacccagagaacg
ggatcccccactagggaggacaagaagcaggcacccatcaagaggcagctgatgaccagc
tttatcctgggctccctcgatgacaactcctctgacgaggaccctagttctaactccttt
cagacctcctctcggaagggcagcagggatagcctgggcacctgttcccaggaggctgca
ttgaacacagctgatcctgagtctcacacacctactatgaggcccagcatgtctggactc
catctggtgaagagaggccgtgaacacaagaaactggacctgcacagagatttcactgta
gcttccccagccgaatttgtcacccgctttggaggcaacagggttatcgagacggtgctc
atcgccaataatggtatcgctgcggtcaagtggatgcgctccatccgccgctgggcctat
gagatgttccgtaatgaacgcgctatccggtttgtggttatggtgacacccgaggatctt
aaggccaacgcagagtactacaagatggcggacccagtacttccggtcccaggaggaccc
aataataacaactacgccaacgttgagctgatcatagacattgccaagagaatccctgtg
caggccgtgtgggctggctggggccacgcttcggaaaaccccaaacttccagagctactg
tgcaagcacgggattgcttttctaggtccccgagtgaggccaatgttgggcctgggagac
aggctctcctccaccattgtagcccagacattgcagatcccaactctaccctggagcgga
agcggtctcacagtggagtggacggaggacagccagcatcagggcaaatgcatcagcgtc
acggaagacgtttatgaacaaggctgtgtgagagatgtggacgaaggcttgcaggcagca
gaaaaagtaggatttcctctgatgatcaaagcctctgaaggtggaggagggaaaggaatc
cggcaggctgagagtgcagaggacttcccatgctttttcagacaggtgcagagtgagatc
ccgggctcgcccatctttctcatgaagctggcccagaatgcccggcacttggaggtccag
gtcttggcagatcagtatgggaacgcagtgtccctgtttggacgagactgctccatccag
aggcggcaccagaagatcattgaggaggctccggccaacatcgctgctccggctgtgttt
gagttcatggaacagtgtgccgtcctcctggccaagactgtggtttatgtgagcgcggga
accgtggggtacctatacagccaggatggcagctttcacttcttggagctgaacccacgc
ctgcaggtggaacatccctgcactgaaatgattgcagatgtcaacctgcccgctgcacag
ttacagatcgccatgggcgtgcccctgcaccggctgaaggacatacggcttctgtacgga
gagtccccctggggagtgacccccgtttcttttgagacccctttgagccctcccattgcc
cgaggccatgtcattgcagccaggatcaccagcgaaaacccagacgaggcctttaagcca
agctcagggacagtacaggagctgaacttccgcagcaacaagaacgtgtggggttacttc
agcgtggccgctgctggaggcttgcacgagtttccgatttcccagtttgggcactgcttc
tcctggggcgagaaccaggaagaggctatttcgaacatggtggtggctttgaaagaactg
tctatccggggtgacttccggaccaccgtggaatatctcgtcaaccttctggagacggag
agcttacagaacaatgatatcgacacggggtggctggaccacctcatcgctcagcgggtg
caggcagagaagccggacatcatgctcggggtggtgtttggggccttgaacgtggcagac
gcaatgttcagaacctgtattacggaattcctgcattccttggaaaggggtcaggtcctc
ccggctgattctctgctgaacatcgtggacgttgaattgatttacggaggcatcaaatat
gttctcaaggtggcccggcagtccctgaccatgtttgtcctcatcatgaatggttgccac
atcgagatcgatgcccaccggccgaacgatgggggcctgctcctgtcctacaatggtagc
agttacactacatacatgaaggaagaggtggacagttaccggatcactatcggcaataag
acatgcgtgtttgaaaaggaaaacgaccccaccgtcctgagatccccctcggctgggaag
ctgatgcagtacacggtggaggatggccagcacgtggaagtcgggagcagctatgctgag
atggaggtgatgaagatgatcatgaccctgaacgtgcaagagagcggccgggtgaactac
atcaagcgaccaggggcggtattggaggctggctgcgtggtggcaaagctagaactcgat
gacccttcaaaagtgcacgcggcacagccgttcacaggggagctccccgcccagcagact
ctgcccatcctcggggagaggctgcatcaggtgttccacagcgtcttggaaaatctgacc
aatgtcatgaatggctactgcctgcccgagcccttcttcagcatgaagctgaaggactgg
gtggagaagcccatgatgactctccggcatccctccctacctctgctggagctgcaggag
atcatgaccagcgtggcagaccgcatcccggttccggtggagaaggcagtccgcagggtg
tttgcgcaggacgccagcaacatcacttcggtgctctgccagttccccagccagcagata
gccaccatcctggactgccacgccgccaccctgcagcgtaaggtggaccgagaggccttc
ttcatgaacacacagagcatcgtgcagctgatccagagataccgcagtgggacccgtggc
atcatgaaggctgtggtgctagacctcctgaggagatatctgaacgtggagcatcatttc
cagcaagcccactatgacaagtgtgtgatcaacctgagggagcagttcaaggcggacatg
actcgggtgctggactgcatcttctcacactcacaagtggccaagaagaaccagctggtg
accatgttgatagatgagctgtgtggcccagaccccaccctgtcagaagagctgacctcc
atcctcaaggaactcacgcagttgagcaggagtgagcactgcaaggtggccctcagagcc
aggcaggtcctgattgcctctcacctcccctcctacgagctgcggcacaaccaggtggag
tcatcttcctgtcagccattgacatgtaatggccaccagttctgcccggaaaacctcaag
aaactaatactttcggaaacgaccatattcgatgtcctgcccactttcttctatcacgct
aacaaggtcgtctgtatggcgtccctggaggtttatgtgaggagaggttacatcgcctac
gagttaaacagcctacagcaccgggagctccctgacggcacctgcgtggtggagttccag
ttcatgctgccgtcttcccaccccaaccggatggccatgcccatcaatgtctctgaccct
gacctgctgagacacagtaaggaactcttcatggacagtggcttctccccactgtgtcac
cagcggatgggggccatggtggccttcaggagatttgaggagttcaccaggaacttcgat
gaagtcatctcctgctttgccaacgtgcctacagacactcctctcttcagtaaggcgtgc
acttccctctactcagaggaggacagcaagagccttcaagaggagcccatccacatcctg
aatgtggccatccagtgcgccgaccacatggaggacgagagactggtgccggttttccgt
gcctttgtacagtccaagaaacacatccttgtggattacggactgcgaagaatcacattc
cttatcgcccaagagaaggaatttcccaagttcttcacgttcagagcgagagatgagttt
gcagaagaccggatttaccgccacttggagccgggcctggccttccagctggagctgagc
cggatgcgcaactttgacttgacggccgtgccctgtgccaaccataagatgcatctttac
ctgggagccgccaaggtgaaggaagggctggaggtgactgaccacaggttcttcatccga
gccatcataaggcactcagacctgatcaccaaggaagcctccttcgagtacctgcagaat
gaaggggagcggctgctgctggaagccatggacgagctggaggtggcgttcaacaacacc
agcgtgcgcactgactgcaaccacatcttcctcaacttcgtggcccacgtcatcatggac
ccactcaagatcgaggagtcggtgcgtgccatggtcatgcgttacggcagtcggctgtgg
aagctccgtgtgctgcaggcacaagttaagatcaacatccgtcagacgacctcggactgc
gccgtccccattcgcctcttcatcaccaacgagtccggctactacctggacatcagcctc
tacaaagaagtgaccgactccagatccggaaacatcatgtttcattccttcggcaacaaa
caagggagcctgcacgggatgctgatcaacacgccctacgtcaccaaggatctgctccaa
gccaagcgattccaggcgcagtccctggggaccacctatgtgtacgacttcccagagatg
ttcaggcaggctctctttaaattgtggggctccccagagaagtacgggcccgatatcctg
acatacacagagctggtgttggactcccagggccagctggtggagatgaaccggcttcct
ggttgtaacgaggtgggcatggtggttttcaaaatgaggttcaagaccccggagtatcca
gaaggccgggacactatcgtcatcggcaacgacattaccttccaaatcggctctttcggc
ataggagaggacttcctgtatctacgggcatcggagatggcccggacagagggcatcccc
caaatctatctggcagccaacagcggcgccgtattgggcctgtccgaggagatcaagcag
atattccaagtggcatgggtggaccctgaggatccctacaaaggatttagatacctgtac
ctgtacctgacgccccaagactacacccagatcagctcccagaactccgtgcactgcaaa
cacatcgaggacgaaggcgagtcaggtattatcgttgatgtcatcgggaaggacagcagc
ctgggtgtggagaacctgcggggctcgggcatgattgcaggagaggcttctctggcttac
gaaaaaaatgtcaccatcagcatggtcgactgccgcgccatcggaatcggggcttacctg
gtgaggctgggccagcgggtgatccaggtggaaaactcccacatcatcctcacgggagcc
ggtgctctcaacaaggttctgggaagagaggtctacacatccaacaaccaactgggcggt
gtgcagatcatgcacaccaacggggtctcccacgtcacggtgccagatgacttcgagggg
gtctgcaccattctggaatggctgtcatatataccaaaggacaatcaaagcccagtcccc
atcatcactccttctgaccccatcgacagggaaattgaattcaccccaaccaaagctccc
tatgaccccaggtggctgctggcagggaggcctcacccaactctgaaggggacctggcag
agtggattcttcgaccatggcagtttcaaggaaatcatggcaccctgggaccagactgtg
gtgactggacgagcaaggctggggggcatccctgtaggggtgattgccgtggagactcgg
tctgtggaggtggctgtccctgctcacccagccaacttggattctgaggccaagatcatc
cagcaggcaggccaggtgtggttcccggactctgccttcaagacggctcaggtcatcagg
gacttcaaccaggagcatctgcttctcatgatctttgctaactggagaggcttctcgggc
ggcatgaaagacatgtccgagcagatgctgaagtttggcgcctacatcgtggacagtctc
cgtctgtccaagcagccagtcctcatctatatccctcccggtgccgaactccgagggggc
tcctgggttgtcctcgactccagcatcaaccccctgtgcatagagatgtacgcagacaaa
gagagcagggggggtgttctggagcccgagggcactgtggagattaagttccggaagaaa
gatttggtgaagaccataaggaggattgacccagtgtgcaagaaactcctggaaccagct
ggggacacccagctccctgacaaggaccggaaagagctggagagccagctgaaggcccgg
gaggacctgctgctccccatctaccaccaggtggcagtgcagttcgccgacctgcatgac
acgccgggccacatgctgaagaagggaatcatttctgatgtcctggagtggaagaccaca
cgtacttacttctactggaggctgcgccggctgctgctggaggcacaggtgaagcaggag
attctgcgagccagccctgagctgagccatgagcacacgcagtccatgctgcgacgctgg
tttgtggagaccgagggcgccgtcaaggcctacctgtgggacagcaaccaggtggtagtc
cagtggctggaacagcactggtcagccagggacaacctgcgttccactatccgagagaac
ctcaattatctgaagcgggactctgtcctcaagaccatccaaagcctagttcaagaacac
ccagaggcgaccatgggactgtgtggatacctgagccagcacctcacgcccgctgagcag
atgcaggtggttcagctgctgtcgaccacggagagcccagcttcccactga

DBGET integrated database retrieval system