KEGG   Rattus norvegicus (rat): 117273Help
Entry
117273            CDS       T01003                                 

Gene name
Rhoa, Arha, Arha2
Definition
(RefSeq) ras homolog family member A
  KO
K04513  
Ras homolog gene family, member A
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Endocytosis
mTOR signaling pathway
Vascular smooth muscle contraction
Wnt signaling pathway
TGF-beta signaling pathway
Axon guidance
Focal adhesion
Adherens junction
Tight junction
Platelet activation
T cell receptor signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Pancreatic secretion
Bacterial invasion of epithelial cells
Pertussis
Tuberculosis
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    117273 (Rhoa)
   04015 Rap1 signaling pathway
    117273 (Rhoa)
   04310 Wnt signaling pathway
    117273 (Rhoa)
   04350 TGF-beta signaling pathway
    117273 (Rhoa)
   04072 Phospholipase D signaling pathway
    117273 (Rhoa)
   04071 Sphingolipid signaling pathway
    117273 (Rhoa)
   04024 cAMP signaling pathway
    117273 (Rhoa)
   04022 cGMP - PKG signaling pathway
    117273 (Rhoa)
   04150 mTOR signaling pathway
    117273 (Rhoa)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    117273 (Rhoa)
  Cell motility
   04810 Regulation of actin cytoskeleton
    117273 (Rhoa)
  Cellular commiunity
   04510 Focal adhesion
    117273 (Rhoa)
   04520 Adherens junction
    117273 (Rhoa)
   04530 Tight junction
    117273 (Rhoa)
 Organismal Systems
  Immune system
   04611 Platelet activation
    117273 (Rhoa)
   04660 T cell receptor signaling pathway
    117273 (Rhoa)
   04670 Leukocyte transendothelial migration
    117273 (Rhoa)
   04062 Chemokine signaling pathway
    117273 (Rhoa)
  Endocrine system
   04921 Oxytocin signaling pathway
    117273 (Rhoa)
  Circulatory system
   04270 Vascular smooth muscle contraction
    117273 (Rhoa)
  Digestive system
   04972 Pancreatic secretion
    117273 (Rhoa)
  Nervous system
   04722 Neurotrophin signaling pathway
    117273 (Rhoa)
  Development
   04360 Axon guidance
    117273 (Rhoa)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    117273 (Rhoa)
   05206 MicroRNAs in cancer
    117273 (Rhoa)
   05205 Proteoglycans in cancer
    117273 (Rhoa)
   05203 Viral carcinogenesis
    117273 (Rhoa)
   05210 Colorectal cancer
    117273 (Rhoa)
  Infectious diseases
   05133 Pertussis
    117273 (Rhoa)
   05152 Tuberculosis
    117273 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    117273 (Rhoa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117273 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   117273 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   117273 (Rhoa)
  Exosomal proteins of bladder cancer cells
   117273 (Rhoa)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    117273 (Rhoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacggtgtttgaa
aactatgtggcagatattgaagtggacgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgtctgaggcctctctcctacccagacactgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctagttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagttagccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagacggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgcgggaagaaaaagtcggggtgcctcatcttgtga

DBGET integrated database retrieval system