KEGG   Rattus norvegicus (rat): 117273Help
Entry
117273            CDS       T01003                                 

Gene name
Rhoa, Arha, Arha2
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04150  mTOR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04660  T cell receptor signaling pathway
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04972  Pancreatic secretion
rno05100  Bacterial invasion of epithelial cells
rno05133  Pertussis
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    117273 (Rhoa)
   04015 Rap1 signaling pathway
    117273 (Rhoa)
   04310 Wnt signaling pathway
    117273 (Rhoa)
   04350 TGF-beta signaling pathway
    117273 (Rhoa)
   04072 Phospholipase D signaling pathway
    117273 (Rhoa)
   04071 Sphingolipid signaling pathway
    117273 (Rhoa)
   04024 cAMP signaling pathway
    117273 (Rhoa)
   04022 cGMP - PKG signaling pathway
    117273 (Rhoa)
   04150 mTOR signaling pathway
    117273 (Rhoa)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    117273 (Rhoa)
  Cellular community - eukaryotes
   04510 Focal adhesion
    117273 (Rhoa)
   04520 Adherens junction
    117273 (Rhoa)
   04530 Tight junction
    117273 (Rhoa)
  Cell motility
   04810 Regulation of actin cytoskeleton
    117273 (Rhoa)
 Organismal Systems
  Immune system
   04611 Platelet activation
    117273 (Rhoa)
   04621 NOD-like receptor signaling pathway
    117273 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    117273 (Rhoa)
   04660 T cell receptor signaling pathway
    117273 (Rhoa)
   04670 Leukocyte transendothelial migration
    117273 (Rhoa)
   04062 Chemokine signaling pathway
    117273 (Rhoa)
  Endocrine system
   04921 Oxytocin signaling pathway
    117273 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    117273 (Rhoa)
  Circulatory system
   04270 Vascular smooth muscle contraction
    117273 (Rhoa)
  Digestive system
   04972 Pancreatic secretion
    117273 (Rhoa)
  Nervous system
   04722 Neurotrophin signaling pathway
    117273 (Rhoa)
  Development
   04360 Axon guidance
    117273 (Rhoa)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    117273 (Rhoa)
   05206 MicroRNAs in cancer
    117273 (Rhoa)
   05205 Proteoglycans in cancer
    117273 (Rhoa)
   05203 Viral carcinogenesis
    117273 (Rhoa)
   05210 Colorectal cancer
    117273 (Rhoa)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    117273 (Rhoa)
  Infectious diseases
   05133 Pertussis
    117273 (Rhoa)
   05152 Tuberculosis
    117273 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    117273 (Rhoa)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    117273 (Rhoa)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117273 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   117273 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   117273 (Rhoa)
  Exosomal proteins of bladder cancer cells
   117273 (Rhoa)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    117273 (Rhoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 117273
NCBI-ProteinID: NP_476473
RGD: 619921
Ensembl: ENSRNOG00000050519
UniProt: P61589
Structure
PDB: 

Jmol
Position
8q32
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacggtgtttgaa
aactatgtggcagatattgaagtggacgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgtctgaggcctctctcctacccagacactgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctagttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagttagccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagacggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgcgggaagaaaaagtcggggtgcctcatcttgtga

DBGET integrated database retrieval system