KEGG   Rattus norvegicus (rat): 140693Help
Entry
140693            CDS       T01003                                 

Gene name
Plcd4
Definition
phospholipase C, delta 4 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    140693 (Plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    140693 (Plcd4)
   04070 Phosphatidylinositol signaling system
    140693 (Plcd4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    140693 (Plcd4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     140693 (Plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q33
AA seq 772 aa AA seqDB search
MASQIQKLLTTNQDLLLMQKGTMMRKVRTKSWKKLRYFRLQDDGMTVWHGRHLESISKPT
FSISDVERIRKGQDSELLRYLVEEFPLEQGFTIVFNGRRPNLDLVANSVEEAQTWMRGLQ
LLVDLVARMNYQEQLDQMLREWFQQADRNQDSRMSFREAQRLLLLMNVEMDEEYAFSLFQ
EADVSQSNTLDSEEFVQFYKALTKRTEIEELFENFSSDKQKLTLLEFVDFLREEQKESDH
SSDLALKLIDRYEPSENGRLLRVLSKDGFLSYLCSADGNIFNPDCLPIYQDMTQPLSHYY
INSSHNTYLLGDQFCGQSSVEGYIRALKRGCRCVEVDTWDGPDGEPVVYHGRTLTSRILF
KDVLATLAQYAFQSSDYPLILSLDNHCTWEQQKTMAHHLIAILGEQLLSTTLEEQLIDIM
PSPEQLRGKILVKGKKLRTIEVVESDKEEEELEKDEGSDLDPASAELDMQSQPESQEQAS
GNKSKNKKKFLLQSSTTILCPDLSALVVYLRTAPFCSFTHSKENYHIYDISSFSESKAKN
LIREAGNEFVQHNARQLCRVYPSGLRTDSSNYNPQEHWNVGCQMVAMNMQTAGSAMDICD
GLFRQNGGSGYVLKPEFLRDTQSSFNPMKPVSLYKAQILVVQVISGQRLPKVDKTKETTV
VDPLVRVELYGVPEDTKQQETSYVENNGINPYWGETFYFQIQVPELAMLRFVVKDYSRTS
RNNFIGQYTLPWTCMKHGYRHVSLLSKDGTSLHPASIFVYTCMQEDLDMDEP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcagattcaaaagctactgaccactaatcaggacctgctgctgatgcaaaaa
ggaacgatgatgcgcaaggtgaggaccaaaagctggaagaagctaagatacttcagactt
caggatgacggcatgacggtctggcatgggcggcaccttgaaagcatatccaagcccact
ttttcaatctctgatgtggagaggatccgtaagggccaggattctgagctgttgcgctat
ctggtggaagagttccccctggagcaaggcttcaccattgtctttaatgggcgccgcccc
aacctggacctagtggccaacagtgttgaagaggcccagacttggatgcgaggactccag
ctgttggtggatctcgtcgccagaatgaactaccaggagcagctggatcaaatgttgaga
gaatggttccaacaagcagacagaaaccaggacagccggatgagtttcagagaagctcaa
cggctgctgcttctgatgaatgtggaaatggatgaagaatatgccttcagtctttttcag
gaagcagatgtttcccaatctaatactctggattcagaagaatttgtacagttctataag
gccctgactaagcgcactgagattgaagaactatttgagaacttttcatctgacaaacag
aagctgaccttgctggaatttgtagatttccttagagaggaacagaaagaaagcgaccat
tcctctgaccttgctctgaaactcattgaccgctatgagccttctgagaatggcagattg
ctacgtgtgctgagcaaggatggcttcctcagctacctctgctcagcggatggaaacatc
ttcaaccccgactgcctccctatctatcaggatatgactcagcctctgagtcactactac
atcaactcctctcacaacacctacctactgggtgaccagttttgtggccagagcagcgtt
gaaggatacatacgggccttgaaacgggggtgccgctgtgtggaggtggatacatgggac
ggacctgacggagagcccgttgtttatcatgggcgtacactgacctctcgtatcctgttc
aaagatgttttggcaacattagcacaatatgccttccagtcgtcagactacccactcatc
ttatctctggataaccactgcacttgggaacagcagaagaccatggcacaccatctgatt
gcgatcctgggagagcagctgctgagtaccaccctagaggaacaactgattgatataatg
ccctcgccagagcagcttcgggggaagatcttggtaaaaggaaagaagttgagaacaatt
gaggttgttgagtctgacaaggaggaagaagagctggagaaagatgaggggtcagatctg
gacccagcctccgctgagcttgacatgcagtctcagcccgagtcccaggagcaggcctct
gggaacaagagcaagaacaagaagaagtttcttctccagagttccacaaccatcctatgc
ccagacctatctgccctggttgtctacttgaggactgctcccttctgcagcttcactcac
tccaaagaaaactaccacatctacgacatttcatccttttctgagtccaaggccaagaac
ctcatcagggaggcaggcaatgagtttgtacagcacaatgccagacagctatgccgtgta
taccccagtggtctgaggacagattcatcgaactataacccccaggaacactggaatgtt
ggctgccaaatggtggccatgaacatgcagactgcaggaagtgcaatggacatctgtgat
gggctcttccgccagaatgggggctctggctatgtgctgaagccagaattcctgagagat
acccagagttccttcaatcccatgaagcccgttagtctttataaagcccagatccttgta
gtccaggtgatcagtggtcaaagactccccaaagtggacaaaaccaaagagacaaccgtt
gtggatccactggtgagagtagagctctatggtgttcctgaagacacaaagcagcaagag
accagctatgtggagaacaatggtattaatccatactggggggagacattctatttccag
atccaggtgcctgaacttgctatgctgcgttttgtggtaaaggattatagcaggacatcc
cgaaataactttataggccaatacaccctgccttggacctgcatgaaacatggctaccga
catgtatccttgctctccaaagacggcactagcctccatccagcctccatctttgtgtac
acctgcatgcaagaagacctggatatggatgagccctga

DBGET integrated database retrieval system