KEGG   Rattus norvegicus (rat): 140693Help
Entry
140693            CDS       T01003                                 

Gene name
Plcd4
Definition
(RefSeq) phospholipase C, delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    140693 (Plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    140693 (Plcd4)
   04070 Phosphatidylinositol signaling system
    140693 (Plcd4)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    140693 (Plcd4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    140693 (Plcd4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     140693 (Plcd4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    140693 (Plcd4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    140693 (Plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 PH_12 GDPD EF-hand_8
Motif
Other DBs
NCBI-GeneID: 140693
NCBI-ProteinID: NP_542419
RGD: 621025
Ensembl: ENSRNOG00000016361
UniProt: Q62711
Position
9q33
AA seq 772 aa AA seqDB search
MASQIQKLLTTNQDLLLMQKGTMMRKVRTKSWKKLRYFRLQDDGMTVWHGRHLESISKPT
FSISDVERIRKGQDSELLRYLVEEFPLEQGFTIVFNGRRPNLDLVANSVEEAQTWMRGLQ
LLVDLVARMNYQEQLDQMLREWFQQADRNQDSRMSFREAQRLLLLMNVEMDEEYAFSLFQ
EADVSQSNTLDSEEFVQFYKALTKRTEIEELFENFSSDKQKLTLLEFVDFLREEQKESDH
SSDLALKLIDRYEPSENGRLLRVLSKDGFLSYLCSADGNIFNPDCLPIYQDMTQPLSHYY
INSSHNTYLLGDQFCGQSSVEGYIRALKRGCRCVEVDTWDGPDGEPVVYHGRTLTSRILF
KDVLATLAQYAFQSSDYPLILSLDNHCTWEQQKTMAHHLIAILGEQLLSTTLEEQLIDIM
PSPEQLRGKILVKGKKLRTIEVVESDKEEEELEKDEGSDLDPASAELDMQSQPESQEQAS
GNKSKNKKKFLLQSSTTILCPDLSALVVYLRTAPFCSFTHSKENYHIYDISSFSESKAKN
LIREAGNEFVQHNARQLCRVYPSGLRTDSSNYNPQEHWNVGCQMVAMNMQTAGSAMDICD
GLFRQNGGSGYVLKPEFLRDTQSSFNPMKPVSLYKAQILVVQVISGQRLPKVDKTKETTV
VDPLVRVELYGVPEDTKQQETSYVENNGINPYWGETFYFQIQVPELAMLRFVVKDYSRTS
RNNFIGQYTLPWTCMKHGYRHVSLLSKDGTSLHPASIFVYTCMQEDLDMDEP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcagattcaaaagctactgaccactaatcaggacctgctgctgatgcaaaaa
ggaacgatgatgcgcaaggtgaggaccaaaagctggaagaagctaagatacttcagactt
caggatgacggcatgacggtctggcatgggcggcaccttgaaagcatatccaagcccact
ttttcaatctctgatgtggagaggatccgtaagggccaggattctgagctgttgcgctat
ctggtggaagagttccccctggagcaaggcttcaccattgtctttaatgggcgccgcccc
aacctggacctagtggccaacagtgttgaagaggcccagacttggatgcgaggactccag
ctgttggtggatctcgtcgccagaatgaactaccaggagcagctggatcaaatgttgaga
gaatggttccaacaagcagacagaaaccaggacagccggatgagtttcagagaagctcaa
cggctgctgcttctgatgaatgtggaaatggatgaagaatatgccttcagtctttttcag
gaagcagatgtttcccaatctaatactctggattcagaagaatttgtacagttctataag
gccctgactaagcgcactgagattgaagaactatttgagaacttttcatctgacaaacag
aagctgaccttgctggaatttgtagatttccttagagaggaacagaaagaaagcgaccat
tcctctgaccttgctctgaaactcattgaccgctatgagccttctgagaatggcagattg
ctacgtgtgctgagcaaggatggcttcctcagctacctctgctcagcggatggaaacatc
ttcaaccccgactgcctccctatctatcaggatatgactcagcctctgagtcactactac
atcaactcctctcacaacacctacctactgggtgaccagttttgtggccagagcagcgtt
gaaggatacatacgggccttgaaacgggggtgccgctgtgtggaggtggatacatgggac
ggacctgacggagagcccgttgtttatcatgggcgtacactgacctctcgtatcctgttc
aaagatgttttggcaacattagcacaatatgccttccagtcgtcagactacccactcatc
ttatctctggataaccactgcacttgggaacagcagaagaccatggcacaccatctgatt
gcgatcctgggagagcagctgctgagtaccaccctagaggaacaactgattgatataatg
ccctcgccagagcagcttcgggggaagatcttggtaaaaggaaagaagttgagaacaatt
gaggttgttgagtctgacaaggaggaagaagagctggagaaagatgaggggtcagatctg
gacccagcctccgctgagcttgacatgcagtctcagcccgagtcccaggagcaggcctct
gggaacaagagcaagaacaagaagaagtttcttctccagagttccacaaccatcctatgc
ccagacctatctgccctggttgtctacttgaggactgctcccttctgcagcttcactcac
tccaaagaaaactaccacatctacgacatttcatccttttctgagtccaaggccaagaac
ctcatcagggaggcaggcaatgagtttgtacagcacaatgccagacagctatgccgtgta
taccccagtggtctgaggacagattcatcgaactataacccccaggaacactggaatgtt
ggctgccaaatggtggccatgaacatgcagactgcaggaagtgcaatggacatctgtgat
gggctcttccgccagaatgggggctctggctatgtgctgaagccagaattcctgagagat
acccagagttccttcaatcccatgaagcccgttagtctttataaagcccagatccttgta
gtccaggtgatcagtggtcaaagactccccaaagtggacaaaaccaaagagacaaccgtt
gtggatccactggtgagagtagagctctatggtgttcctgaagacacaaagcagcaagag
accagctatgtggagaacaatggtattaatccatactggggggagacattctatttccag
atccaggtgcctgaacttgctatgctgcgttttgtggtaaaggattatagcaggacatcc
cgaaataactttataggccaatacaccctgccttggacctgcatgaaacatggctaccga
catgtatccttgctctccaaagacggcactagcctccatccagcctccatctttgtgtac
acctgcatgcaagaagacctggatatggatgagccctga

DBGET integrated database retrieval system