KEGG   Rattus norvegicus (rat): 24163Help
Entry
24163             CDS       T01003                                 

Gene name
Acr, Acro
Definition
acrosin (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     24163 (Acr)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   24163 (Acr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34-q35
AA seq 437 aa AA seqDB search
MVEMLPTVVALVLAVSVVAKDNTTCDGPCGLRFRQNPQAGIRIVGGQTSSPGAWPWMVSL
QIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYDWRLVFGAHEIEYGRNKPVKEP
QQERYVQKIVIHEKYNAVTEGNDIALLKVTPPVTCGDFVGPGCLPHFKSGPPRIPHTCYV
TGWGYIKDNAPRPSPVLMEARVDLIDLDLCNSTQWYNGRVTSTNVCAGYPEGKIDTCQGD
SGGPLMCRDSVDSPFVIVGITSWGVGCARAKRPGVYTATWDYLDWIASKIGPTALHLIQP
ATPHPPTTQQPVISFHPPSIHPPWYFQHLSPRPPHLRPPRPLLHQPSSVHTSSAPVIPLL
SLLTPVQPVSFTLAAYHTRHHTTLSFARRLQHLIEALKMRTYPIKYPSRYSGPVNYQHRF
STFEPLSNKPSEPLLHS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtagagatgctgccaactgtcgttgcgctggtcctggcagtgtccgtggttgccaag
gataacaccacgtgtgatggcccctgtgggttacgattcaggcagaacccacaagcaggt
atccggattgtcggagggcagacttcgtcgcctggggcctggccctggatggtcagttta
cagatcttcacgtcccataacagccgtaggtatcacgcctgcggaggcagcctactgaac
tcccactgggtgctcacggctgctcactgcttcgataacaaaaaaaaagtctatgactgg
agactggtttttggagcccatgaaattgaatacggaagaaacaagccagtgaaagagccc
cagcaggaaagatacgtgcagaaaattgtcatccacgagaaatacaacgctgtgaccgag
gggaacgacattgccctcttgaaagtcactcctcctgttacatgtggggacttcgttggg
cctggctgcctacctcattttaagtctggtcctcccagaatcccccacacctgctacgtg
actgggtggggatacataaaagataacgcccccagaccatcacctgtcctgatggaggcc
cgcgtggatctcattgacctcgacctgtgtaactccacccagtggtacaatgggcgtgtc
acatcaactaatgtgtgcgcagggtatcctgaaggcaagattgacacctgccagggggac
agtggtgggcctctcatgtgcagagacagcgtcgacagcccctttgtgatcgtggggatc
acgagctggggggtaggctgtgcccgtgctaagcgtcctggagtctacacagccacctgg
gactacctggactggattgcttccaagatcggccctaccgccttgcacttgattcaaccg
gccacccctcacccacctacaacccagcaaccggtcatctctttccaccctccttcgatc
caccctccttggtacttccaacacctgtctcctcggccgcctcacctacgaccgcctcgg
cctctgctccatcagccgtcttcagtccatacctcctcagctccagtcatacctctactc
tccctgctcaccccagtccagcctgtgtcctttacccttgctgcgtaccacacaaggcac
cacacaacgctgtcttttgctcggcgtctacagcatctcatagaggccctgaagatgaga
acttaccctataaaatatccctcccggtacagtggacctgtgaactaccagcaccgcttc
tccacgttcgagcccctttccaacaaacccagtgagcccctcctccattcctga

DBGET integrated database retrieval system