KEGG   Rattus norvegicus (rat): 24179Help
Entry
24179             CDS       T01003                                 

Gene name
Agt, ANRT, Ang, AngII, PAT
Definition
(RefSeq) angiotensinogen
  KO
K09821  
angiotensinogen
Organism
rno  Rattus norvegicus (rat)
Pathway
Renin-angiotensin system
Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    24179 (Agt)
   04614 Renin-angiotensin system
    24179 (Agt)
  Circulatory system
   04270 Vascular smooth muscle contraction
    24179 (Agt)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    24179 (Agt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q12
AA seq 477 aa AA seqDB search
MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYYSKSTCAQLENPSVETLPEPTFEP
VPIQAKTSPVDEKTLRDKLVLATEKLEAEDRQRAAQVAMIANFMGFRMYKMLSEARGVAS
GAVLSPPALFGTLVSFYLGSLDPTASQLQVLLGVPVKEGDCTSRLDGHKVLTALQAVQGL
LVTQGGSSSQTPLLQSTVVGLFTAPGLRLKQPFVESLGPFTPAIFPRSLDLSTDPVLAAQ
KINRFVQAVTGWKMNLPLEGVSTDSTLFFNTYVHFQGKMRGFSQLTGLHEFWVDNSTSVS
VPMLSGTGNFQHWSDAQNNFSVTRVPLGESVTLLLIQPQCASDLDRVEVLVFQHDFLTWI
KNPPPRAIRLTLPQLEIRGSYNLQDLLAQAKLSTLLGAEANLGKMGDTNPRVGEVLNSIL
LELQAGEEEQPTESAQQPGSPEVLDVTLSSPFLFAIYERDSGALHFLGRVDNPQNVV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgactcccacgggggcaggcctgaaggccaccatcttctgcatcctgacctgggtcagc
ctgacagctggggaccgcgtatacatccacccctttcatctcctctactacagcaagagc
acctgcgcccagctggagaaccccagtgtggagacgctcccagagccaacctttgagcct
gtgcccattcaggccaagacctcccccgtggatgagaagaccctgcgagataagctcgtg
ctggccactgagaagctagaggctgaggatcggcagcgagctgcccaggtcgcgatgatt
gccaacttcatgggtttccgcatgtacaagatgctgagtgaggcaagaggtgtagccagt
ggggccgtcctctctccaccggccctctttggcaccctggtctctttctaccttggatcg
ttggatcccacggccagccagttgcaggtgctgctgggcgtccctgtgaaggagggagac
tgcacctcccggctggacggacataaggtcctcactgccctgcaggctgttcagggcttg
ctggtcacccagggtggaagcagcagccagacacccctgctacagtccaccgtggtgggc
ctcttcactgccccaggcttgcgcctaaaacagccatttgttgagagcttgggtcccttc
acccccgccatcttccctcgctctctggacttatccactgacccagttcttgctgcccag
aaaatcaacaggtttgtgcaggctgtgacagggtggaagatgaacttgccactagagggg
gtcagcacggacagcaccctatttttcaacacctacgttcacttccaagggaagatgaga
ggcttctcccagctgactgggctccatgagttctgggtggacaacagcacctcagtgtct
gtgcccatgctctcgggcactggcaacttccagcactggagtgacgcccagaacaacttc
tccgtgacacgcgtgcccctgggtgagagtgtcaccctgctgctgatccagccccagtgc
gcctcagatctcgacagggtggaggtcctcgtcttccagcacgacttcctgacttggata
aagaacccgcctcctcgggccatccgtctgaccctgccgcagctggaaattcggggatcc
tacaacctgcaggacctgctggctcaggccaagctgtctacccttttgggtgctgaggca
aatctgggcaagatgggtgacaccaacccccgagtgggagaggttctcaacagcatcctc
cttgaactccaagcaggcgaggaggagcagcccacagagtctgcccagcagcctggctca
cccgaggtgctggacgtgaccctgagcagtccgttcctgttcgccatctacgagcgggac
tcaggtgcgctgcactttctgggcagagtggataacccccaaaatgtggtgtga

DBGET integrated database retrieval system