KEGG   Rattus norvegicus (rat): 24691Help
Entry
24691             CDS       T01003                                 

Gene name
Prss1, PTRYI, RATPTRYI, Try1
Definition
protease, serine, 1 (trypsin 1) (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24691 (Prss1)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    24691 (Prss1)
   04974 Protein digestion and absorption
    24691 (Prss1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    24691 (Prss1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     24691 (Prss1)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   24691 (Prss1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24691 (Prss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q22
AA seq 246 aa AA seqDB search
MSALLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLN
ARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEIT
SSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQ
DTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacttctgatcctagcccttgtgggagctgctgttgctttccctttggaagat
gatgacaagatcgttggaggatacacctgcccggaacattctgtcccctaccaggtgtcc
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcactgctacaaatcccgcatccaagtgagactgggagagcacaacatcaatgtc
cttgagggcgatgagcaatttatcaatgctgccaagatcatcaagcaccccaactatagt
tcgtggaccctgaacaatgacatcatgctgatcaagctctcttcccctgtgaaactcaat
gcccgagtggcccctgtagctctgcccagcgcctgtgcacctgcaggcactcagtgcctc
atctctggctggggcaacaccctcagcaatggtgtgaacaacccagacctgctccaatgc
gtggatgccccagtgctgtctcaggctgactgtgaagccgcctaccctggggaaatcacc
agcagcatgatttgtgttggcttcctggagggaggcaaagattcctgccagggtgactct
ggtggcccggtggtctgcaatggacagctccagggtattgtctcctggggctatggttgt
gccctgccagacaaccctggtgtgtacaccaaggtctgcaactttgtgggctggattcag
gacaccattgctgcaaactaa

DBGET integrated database retrieval system