KEGG   Rattus norvegicus (rat): 24715Help
Entry
24715             CDS       T01003                                 

Gene name
Ren, RATRENAA, RENAA, Ren1
Definition
renin (EC:3.4.23.15)
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:rno04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q13
AA seq 402 aa AA seqDB search
MGGRRMPLWALLLLWTSCSFSLPTDTASFGRILLKKMPSVREILEERGVDMTRISAEWGE
FIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT
ACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG
GSDPQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSL
QLIMQALGVKEKRANNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCIL
ALQGLDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaggaggatgcctctctgggcactcttgttgctctggacctcttgtagcttc
agtctcccgacagacacagccagctttggacgaatcttgctcaagaaaatgccctcggtc
cgggaaatcctggaggagcggggagtagacatgaccaggatcagtgctgaatggggtgaa
ttcatcaagaagtcttcctttaccaatgttacctcccccgtggtcctcaccaactacttg
gatacccagtactatggtgagatcggcattggtaccccatcccagaccttcaaagtcatc
tttgacacgggttcagccaacctctgggtgccctccaccaagtgtggtcccctctacact
gcctgtgagattcacaacctctatgactcctcggaatcctctagctacatggagaatggg
actgaattcaccatccactatggatcagggaaggtcaaaggtttcctcagccaagatgtg
gtaactgtgggtggaatcattgtgacacagacctttggagaggtcaccgagctgcccctg
atacccttcatgctggccaagtttgacggggttctgggcatgggcttccctgctcaggct
gttgatggagtcatccctgtcttcgaccacattctctcccagagggtgctaaaggaggaa
gtgttttctgtctactacagcagggagtcccacctgctggggggcgaagtggtgctggga
ggcagtgaccctcaacattaccagggcaactttcactacgtgagcatcagcaaggccggc
tcctggcagatcaccatgaagggggtctctgtggggcctgccaccttgttgtgtgaggag
ggctgtatggcagtggtggacactggcacatcctatatctcgggccctaccagctccctg
cagttgatcatgcaagccctgggagtcaaagagaagagagcaaataattacgttgtgaac
tgtagccaggtacccaccctccccgacatctccttctacctgggaggcaggacctacact
ctcagcaacatggactatgtgcaaaagaatcccttcaggaacgatgacctgtgcatactg
gctctccaaggcctggacatcccaccacccactgggcctgtctgggtcctgggtgccacc
ttcatccgcaagttctatacagagttcgaccggcataacaatcgcatcgggttcgccttg
gcccgctaa

DBGET integrated database retrieval system