KEGG   Rattus norvegicus (rat): 24715Help
Entry
24715             CDS       T01003                                 

Gene name
Ren, RATRENAA, RENAA, Ren1
Definition
renin (EC:3.4.23.15)
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    24715 (Ren)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     24715 (Ren)
Peptidases [BR:rno01002]
 Aspartic Peptidases
  Family A1: pepsin family
   24715 (Ren)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q13
AA seq 402 aa AA seqDB search
MGGRRMPLWALLLLWTSCSFSLPTDTASFGRILLKKMPSVREILEERGVDMTRISAEWGE
FIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT
ACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG
GSDPQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSL
QLIMQALGVKEKRANNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCIL
ALQGLDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaggaggatgcctctctgggcactcttgttgctctggacctcttgtagcttc
agtctcccgacagacacagccagctttggacgaatcttgctcaagaaaatgccctcggtc
cgggaaatcctggaggagcggggagtagacatgaccaggatcagtgctgaatggggtgaa
ttcatcaagaagtcttcctttaccaatgttacctcccccgtggtcctcaccaactacttg
gatacccagtactatggtgagatcggcattggtaccccatcccagaccttcaaagtcatc
tttgacacgggttcagccaacctctgggtgccctccaccaagtgtggtcccctctacact
gcctgtgagattcacaacctctatgactcctcggaatcctctagctacatggagaatggg
actgaattcaccatccactatggatcagggaaggtcaaaggtttcctcagccaagatgtg
gtaactgtgggtggaatcattgtgacacagacctttggagaggtcaccgagctgcccctg
atacccttcatgctggccaagtttgacggggttctgggcatgggcttccctgctcaggct
gttgatggagtcatccctgtcttcgaccacattctctcccagagggtgctaaaggaggaa
gtgttttctgtctactacagcagggagtcccacctgctggggggcgaagtggtgctggga
ggcagtgaccctcaacattaccagggcaactttcactacgtgagcatcagcaaggccggc
tcctggcagatcaccatgaagggggtctctgtggggcctgccaccttgttgtgtgaggag
ggctgtatggcagtggtggacactggcacatcctatatctcgggccctaccagctccctg
cagttgatcatgcaagccctgggagtcaaagagaagagagcaaataattacgttgtgaac
tgtagccaggtacccaccctccccgacatctccttctacctgggaggcaggacctacact
ctcagcaacatggactatgtgcaaaagaatcccttcaggaacgatgacctgtgcatactg
gctctccaaggcctggacatcccaccacccactgggcctgtctgggtcctgggtgccacc
ttcatccgcaagttctatacagagttcgaccggcataacaatcgcatcgggttcgccttg
gcccgctaa

DBGET integrated database retrieval system