KEGG   Rattus norvegicus (rat): 24849Help
Entry
24849             CDS       T01003                                 

Gene name
Tpi1, Tpi
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    24849 (Tpi1)
   01230 Biosynthesis of amino acids
    24849 (Tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24849 (Tpi1)
   00051 Fructose and mannose metabolism
    24849 (Tpi1)
   00562 Inositol phosphate metabolism
    24849 (Tpi1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     24849 (Tpi1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24849 (Tpi1)
  Exosomal proteins of bladder cancer cells
   24849 (Tpi1)
  Exosomal proteins of melanoma cells
   24849 (Tpi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q42
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKKCLGELICTLNAAKLPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHIFGESDELIGQKVNHALSE
GLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWCKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKCNVSEGVAQCTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgtcgggggcaactggaagatgaacgggaggaagaaa
tgcctgggagaactcatctgcactctgaacgcagccaagctgccggcagacaccgaggtg
gtttgtgcaccgccaaccgcctacatcgactttgccaggcagaagctggatcccaaaatt
gctgtggctgcacagaactgctacaaagtgaccaatggggccttcactggggaaatcagt
cctggcatgatcaaggacttaggagctacctgggtggtgctgggacactctgaaagaaga
cacatctttggggaatcagacgagttgattgggcagaaagtgaaccatgccctatccgag
ggactcggagtgatcgcctgcattggggagaagttagacgaaagggaagctggcatcact
gagaaggttgtttttgagcaaaccaaggccatcgcagataatgtgaaggactggtgcaag
gtggtcctggcctatgaaccagtatgggccattgggactggcaagactgcaacccctcaa
caggcccaggaagtacacgagaagctccggggatggctgaaatgcaacgtctctgagggg
gtggctcagtgcactcggatcatttatggaggttctgtgactggagcgacttgcaaagag
ctggcaagccagcctgatgtggatggcttcctcgtgggcggtgcatctctcaagcctgaa
ttcgtggacattatcaatgccaaacaatga

DBGET integrated database retrieval system