KEGG   Rattus norvegicus (rat): 24856Help
Entry
24856             CDS       T01003                                 

Gene name
Ttr, Lr1, TT, Tbpa
Definition
(RefSeq) transthyretin
  KO
K20731  
transthyretin
Organism
rno  Rattus norvegicus (rat)
Pathway
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    24856 (Ttr)
Transporters [BR:rno02000]
 Other Transporters
  Others
   24856 (Ttr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p12
AA seq 147 aa AA seqDB search
MASLRLFLLCLAGLIFASEAGPGGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGS
WEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDS
GHRHYTIAALLSPYSYSTTAVVSNPQN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccttcgcctgttcctcctctgcctcgctggactgatatttgcgtctgaagct
ggccctgggggtgctggagaatccaagtgtcctctgatggtcaaagtcctggatgctgtc
cgaggcagccctgctgtcgatgtggccgtgaaagtgttcaaaaagactgcagacggaagc
tgggagccgtttgcctctgggaagaccgccgagtctggagagctgcacgggctcaccaca
gatgagaagttcacggaaggggtgtacagggtagaactggacaccaaatcgtactggaag
gctcttggcatttccccattccatgaatacgcagaggtggttttcacagccaatgactct
ggtcatcgccactacaccatcgcagccctgctcagcccgtactcctacagcaccactgct
gtcgtcagtaacccccagaactga

DBGET integrated database retrieval system