KEGG   Rattus norvegicus (rat): 24856Help
Entry
24856             CDS       T01003                                 

Gene name
Ttr, Lr1, TT, Tbpa
Definition
(RefSeq) transthyretin
  KO
K20731  transthyretin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    24856 (Ttr)
Transporters [BR:rno02000]
 Other Transporters
  Others
   24856 (Ttr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transthyretin
Motif
Other DBs
NCBI-GeneID: 24856
NCBI-ProteinID: NP_036813
RGD: 3916
Ensembl: ENSRNOG00000016275
UniProt: P02767
Structure
PDB: 

Jmol
Position
18p12
AA seq 147 aa AA seqDB search
MASLRLFLLCLAGLIFASEAGPGGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGS
WEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDS
GHRHYTIAALLSPYSYSTTAVVSNPQN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccttcgcctgttcctcctctgcctcgctggactgatatttgcgtctgaagct
ggccctgggggtgctggagaatccaagtgtcctctgatggtcaaagtcctggatgctgtc
cgaggcagccctgctgtcgatgtggccgtgaaagtgttcaaaaagactgcagacggaagc
tgggagccgtttgcctctgggaagaccgccgagtctggagagctgcacgggctcaccaca
gatgagaagttcacggaaggggtgtacagggtagaactggacaccaaatcgtactggaag
gctcttggcatttccccattccatgaatacgcagaggtggttttcacagccaatgactct
ggtcatcgccactacaccatcgcagccctgctcagcccgtactcctacagcaccactgct
gtcgtcagtaacccccagaactga

DBGET integrated database retrieval system