KEGG   Rattus norvegicus (rat): 25050Help
Entry
25050             CDS       T01003                                 

Gene name
Camk4, Ccdpk, RATCCDPK
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04211  Longevity regulating pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04921  Oxytocin signaling pathway
rno04925  Aldosterone synthesis and secretion
rno05031  Amphetamine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    25050 (Camk4)
   04020 Calcium signaling pathway
    25050 (Camk4)
   04024 cAMP signaling pathway
    25050 (Camk4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    25050 (Camk4)
   04925 Aldosterone synthesis and secretion
    25050 (Camk4)
  Nervous system
   04725 Cholinergic synapse
    25050 (Camk4)
   04720 Long-term potentiation
    25050 (Camk4)
   04722 Neurotrophin signaling pathway
    25050 (Camk4)
  Development
   04380 Osteoclast differentiation
    25050 (Camk4)
  Aging
   04211 Longevity regulating pathway - mammal
    25050 (Camk4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    25050 (Camk4)
   05034 Alcoholism
    25050 (Camk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     25050 (Camk4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   25050 (Camk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo APH YrbL-PhoP_reg GREB1
Motif
Other DBs
NCBI-GeneID: 25050
NCBI-ProteinID: NP_036859
RGD: 2264
Ensembl: ENSRNOG00000020478
UniProt: P13234
Position
18p12
AA seq 474 aa AA seqDB search
MLKVTVPSCPSSPCSSVTSSTENLVPDYWIDGSKRDPLSDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTNIQESNKASSEAQPAQD
GKDKTDPLENKMQAGDHEAAKAAADETMKLQSEEVEEEEGVKEEEEEEEEEEETSRMVPQ
EPEDRLETDDQEMKRNSEETLKSVEEEMDPKAEEEAAAVGLGVPPQQDAILPEY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgtccctcctcgccctgctcctcggtcacctccagt
actgagaacctcgtcccggattactggatcgacggctctaaacgggatcctctgagcgat
ttcttcgaggtggagtcagagctgggacggggtgctacatccattgtgtacagatgcaaa
cagaaggggacccagaagccctatgctctcaaagtgttaaagaaaacagtggacaagaag
atcgtgagaactgaaataggagttctcctgagactctcacacccgaacatcataaaactc
aaggaaatatttgaaacccccacagaaatcagcctggttcttgagctagtcacaggagga
gaactgtttgacaggattgtggagaaaggctattacagtgaacgcgacgcggccgatgct
gtgaagcagatcctggaggcagttgcttacctgcacgaaaatggaatcgtccatcgcgac
ctcaaaccagagaatcttctttatgcaacgccagcccctgatgcaccactcaaaattgct
gattttggactttctaaaatcgtggaacatcaagtgctcatgaagacggtgtgtggaacc
ccggggtactgtgcacctgagattctccgaggctgtgcctatggccccgaggtggacatg
tggtctgtaggaataattacctacatcctactttgtggatttgaaccattctatgatgag
agaggtgatcagttcatgttcaggagaattctgaattgtgaatattactttatctccccc
tggtgggatgaagtttctttaaatgccaaggacttggtcaagaaactcattgttttggac
cctaagaagcggctgactacattccaagccctccaacacccgtgggtcacaggaaaagca
gccaactttgtccacatggataccgctcagaaaaagcttcaagaattcaatgctaggcgc
aagcttaaggcggcagtgaaggctgtggtggcctcttctcggctgggaagtgccagcagc
agtcacaccaacatccaagaaagcaacaaagccagctcggaggcacagcccgcccaagac
ggcaaggacaagacagatcctctggaaaacaaaatgcaagcgggggaccacgaggcagcc
aaggctgcagccgatgagacgatgaagctacagtccgaggaggtggaggaagaggaaggt
gtaaaagaagaggaggaagaggaagaagaggaagaggagacctccaggatggtacctcag
gagccagaggacaggctggagacagatgaccaggaaatgaagagaaattcagaggagacg
ttgaagagtgtggaggaagaaatggacccgaaagctgaggaggaagccgctgccgtggga
cttggggtccctccacagcaggatgctattctgccagagtactaa

DBGET integrated database retrieval system