KEGG   Rattus norvegicus (rat): 25050Help
Entry
25050             CDS       T01003                                 

Gene name
Camk4, Ccdpk, RATCCDPK
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase IV (EC:2.7.11.17)
  KO
K05869  
calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Longevity regulating pathway
Osteoclast differentiation
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    25050 (Camk4)
   04024 cAMP signaling pathway
    25050 (Camk4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    25050 (Camk4)
   04925 Aldosterone synthesis and secretion
    25050 (Camk4)
  Nervous system
   04725 Cholinergic synapse
    25050 (Camk4)
   04720 Long-term potentiation
    25050 (Camk4)
   04722 Neurotrophin signaling pathway
    25050 (Camk4)
  Development
   04380 Osteoclast differentiation
    25050 (Camk4)
  Aging
   04211 Longevity regulating pathway - mammal
    25050 (Camk4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    25050 (Camk4)
   05034 Alcoholism
    25050 (Camk4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     25050 (Camk4)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  CAMK1 family [OT]
   25050 (Camk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
18p12
AA seq 474 aa AA seqDB search
MLKVTVPSCPSSPCSSVTSSTENLVPDYWIDGSKRDPLSDFFEVESELGRGATSIVYRCK
QKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGG
ELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIA
DFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDE
RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKRLTTFQALQHPWVTGKA
ANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHTNIQESNKASSEAQPAQD
GKDKTDPLENKMQAGDHEAAKAAADETMKLQSEEVEEEEGVKEEEEEEEEEEETSRMVPQ
EPEDRLETDDQEMKRNSEETLKSVEEEMDPKAEEEAAAVGLGVPPQQDAILPEY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgtccctcctcgccctgctcctcggtcacctccagt
actgagaacctcgtcccggattactggatcgacggctctaaacgggatcctctgagcgat
ttcttcgaggtggagtcagagctgggacggggtgctacatccattgtgtacagatgcaaa
cagaaggggacccagaagccctatgctctcaaagtgttaaagaaaacagtggacaagaag
atcgtgagaactgaaataggagttctcctgagactctcacacccgaacatcataaaactc
aaggaaatatttgaaacccccacagaaatcagcctggttcttgagctagtcacaggagga
gaactgtttgacaggattgtggagaaaggctattacagtgaacgcgacgcggccgatgct
gtgaagcagatcctggaggcagttgcttacctgcacgaaaatggaatcgtccatcgcgac
ctcaaaccagagaatcttctttatgcaacgccagcccctgatgcaccactcaaaattgct
gattttggactttctaaaatcgtggaacatcaagtgctcatgaagacggtgtgtggaacc
ccggggtactgtgcacctgagattctccgaggctgtgcctatggccccgaggtggacatg
tggtctgtaggaataattacctacatcctactttgtggatttgaaccattctatgatgag
agaggtgatcagttcatgttcaggagaattctgaattgtgaatattactttatctccccc
tggtgggatgaagtttctttaaatgccaaggacttggtcaagaaactcattgttttggac
cctaagaagcggctgactacattccaagccctccaacacccgtgggtcacaggaaaagca
gccaactttgtccacatggataccgctcagaaaaagcttcaagaattcaatgctaggcgc
aagcttaaggcggcagtgaaggctgtggtggcctcttctcggctgggaagtgccagcagc
agtcacaccaacatccaagaaagcaacaaagccagctcggaggcacagcccgcccaagac
ggcaaggacaagacagatcctctggaaaacaaaatgcaagcgggggaccacgaggcagcc
aaggctgcagccgatgagacgatgaagctacagtccgaggaggtggaggaagaggaaggt
gtaaaagaagaggaggaagaggaagaagaggaagaggagacctccaggatggtacctcag
gagccagaggacaggctggagacagatgaccaggaaatgaagagaaattcagaggagacg
ttgaagagtgtggaggaagaaatggacccgaaagctgaggaggaagccgctgccgtggga
cttggggtccctccacagcaggatgctattctgccagagtactaa

DBGET integrated database retrieval system