KEGG   Rattus norvegicus (rat): 25738Help
Entry
25738             CDS       T01003                                 

Gene name
Plcg1, PPLCA
Definition
(RefSeq) phospholipase C, gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04064  NF-kappa B signaling pathway
rno04066  HIF-1 signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04072  Phospholipase D signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04919  Thyroid hormone signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05214  Glioma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05231  Choline metabolism in cancer
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    25738 (Plcg1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25738 (Plcg1)
   04015 Rap1 signaling pathway
    25738 (Plcg1)
   04012 ErbB signaling pathway
    25738 (Plcg1)
   04370 VEGF signaling pathway
    25738 (Plcg1)
   04064 NF-kappa B signaling pathway
    25738 (Plcg1)
   04066 HIF-1 signaling pathway
    25738 (Plcg1)
   04020 Calcium signaling pathway
    25738 (Plcg1)
   04070 Phosphatidylinositol signaling system
    25738 (Plcg1)
   04072 Phospholipase D signaling pathway
    25738 (Plcg1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    25738 (Plcg1)
   04660 T cell receptor signaling pathway
    25738 (Plcg1)
   04658 Th1 and Th2 cell differentiation
    25738 (Plcg1)
   04659 Th17 cell differentiation
    25738 (Plcg1)
   04664 Fc epsilon RI signaling pathway
    25738 (Plcg1)
   04666 Fc gamma R-mediated phagocytosis
    25738 (Plcg1)
   04670 Leukocyte transendothelial migration
    25738 (Plcg1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    25738 (Plcg1)
  Nervous system
   04722 Neurotrophin signaling pathway
    25738 (Plcg1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25738 (Plcg1)
  Development
   04360 Axon guidance
    25738 (Plcg1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25738 (Plcg1)
   05231 Choline metabolism in cancer
    25738 (Plcg1)
   05206 MicroRNAs in cancer
    25738 (Plcg1)
   05205 Proteoglycans in cancer
    25738 (Plcg1)
   05225 Hepatocellular carcinoma
    25738 (Plcg1)
   05214 Glioma
    25738 (Plcg1)
   05223 Non-small cell lung cancer
    25738 (Plcg1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    25738 (Plcg1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    25738 (Plcg1)
   05169 Epstein-Barr virus infection
    25738 (Plcg1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    25738 (Plcg1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     25738 (Plcg1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    25738 (Plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    25738 (Plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 25738
NCBI-ProteinID: NP_037319
RGD: 3347
Ensembl: ENSRNOG00000051490
UniProt: P10686
Structure
PDB: 

Jmol
Position
3q42
AA seq 1290 aa AA seqDB search
MAGVGTPCANGCGPSAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDFEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNTLRT
GERPELCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVT
FLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAILEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERASDASSQLFHVRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtcgggaccccctgcgccaacggctgcgggcccagcgcgccctccgaagcg
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccagaacggaagaccttccaggtcaagttggagacgcgccagatc
acatggagccgcggtgcggacaaaatcgaggggtccatcgatatccgagaaatcaaggag
atccgcccagggaagacttcccgggactttgaccgctaccaagaagaccctgccttccgg
ccagatcagtcacactgttttgtcatcctctatggaatggaattccgcctgaagaccctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctc
atggaagatacgctgcaggcggccacacccctgcaaattgagagatggctccggaagcag
ttctactcagtggatcgtaaccgagaggatcgtatatcagccaaggacctgaagaacatg
ctgtcacaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
tttgaacagcgcagcggggacatcacctatgggcagtttgctcagctttaccgcagcctc
atgtacagcgcccagaagacgatggaccttccgttcttggaaaccaacactttgaggact
ggagagcggccagagctttgccaggtgtccctttctgagttccagcagttccttcttgag
taccagggggagctgtgggctgtcgaccggcttcaggtgcaggaatttatgctcagcttc
cttcgagaccccttgcgagagattgaggagccatacttcttcttggatgagcttgtcacc
tttctgttctccaaagagaacagtgtgtggaactcacagctggatgccgtgtgcccagaa
accatgaacaacccactgtctcactattggatctcttcctcgcataatacgtatctgact
ggggaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgaggatgggc
tgtcgctgcatcgagttggactgctgggatgggccagatgggatgccagtcatttaccat
gggcacaccctcaccaccaagattaagttctcagatgtcctgcacaccatcaaggagcac
gcgttcgtagcctcagagtaccctgtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagcacttcaggaaggtgctcggtgacacgctcctcaccaag
cccgtggacattgccgctgatgggctcccttctcccaaccagctcaagaggaagatcctg
attaagcataagaagctggctgagggcagtgcctatgaggaggtgcctacctctgtgatg
tactctgagaatgacatcagtaactccatcaagaatggtatcctctacttggaggacccc
gtgaatcatgagtggtacccccactactttgttctgactagcagcaagatctactactct
gaggagaccagcagtgaccagggaaatgaggatgaagaggagccgaaggaggccagtggc
agcacagagctgcactcgagcgagaagtggttccacgggaagctcggggctgggcgcgac
gggcggcacattgctgagcgcctgctcaccgagtactgcatagagactggggctcccgat
ggctccttcctagtgcgagaaagtgagaccttcgtgggggactacacgctgtctttttgg
cggaatgggaaagtccagcactgccgtatccactcccggcaggatgctgggactcctaag
ttcttcttgacagataaccttgtctttgactctctctatgacctcatcacacattatcag
caagtgcccctgcgctgcaatgagtttgagatgcgcctttcagagcctgttccacagacg
aatgcccatgagagcaaagagtggtaccacgcaagcctgactagagctcaggctgaacac
atgctgatgcgagtaccccgtgatggggccttcctggtgcggaagcgcaacgagcccaac
tcctatgccatctctttccgggctgagggaaagatcaagcactgccgagtacagcaggaa
ggccagactgtgatgctggggaactctgagtttgacagcctggtcgacctcatcagctac
tatgagaagcatcccctgtaccgcaaaatgaaactgcgctaccccatcaacgaggaggcg
ctggagaagattgggacagctgaacccgattatggggcactgtatgagggccgcaaccct
ggtttctatgtggaggccaaccctatgccaactttcaagtgtgcagtaaaagctctcttc
gactacaaggcccagagagaggatgagctgacttttaccaagagcgccatcatccagaat
gtggaaaagcaagatggtggctggtggcgtggggactatggtgggaagaagcagctgtgg
ttcccctcaaactatgtggaagagatgatcaatccagcaatcctagagccggagagggag
catctggatgagaacagcccactgggggacttgctgcgaggggtcttagatgtgccagcc
tgccagatcgccattcgtcctgagggcaaaaacaaccggctcttcgtcttctccatcagc
atgccgtcagtggctcagtggtccctagacgttgccgctgactcacaggaggagttgcag
gactgggtgaaaaagatccgtgaagttgcccagactgcagatgccaggcttactgagggg
aagatgatggagaggaggaagaagatcgccttggagctctccgagctcgtggtctactgc
cggcctgttccctttgacgaagagaagattggcacagaacgcgcttgttaccgggacatg
tcctcctttccggaaaccaaggctgagaagtatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctctcgcatctaccctaagggtcagaggctggactcc
tccaattatgaccctctgcccatgtggatctgtggcagccagcttgtagctctcaatttt
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggctggtggacactgt
ggctatgtgctgcagccaagcaccatgagagatgaagcctttgacccctttgataagagc
agtctccgaggtctggagccctgtgtcatttgcattgaggtgctgggggccaggcatctg
ccgaagaatggccggggtattgtgtgtcctttcgtggagattgaagtggctggggcagag
tacgacagcaccaagcagaagacagagtttgtagtggacaatggactgaaccctgtgtgg
cctgcaaagcccttccacttccagatcagtaacccagagtttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaagacctg
gagttggcctccctgctcatcaagattgacattttccctgctaaggagaatggtgacctc
agccctttcagtggtacatccctaagggaacgggcctcagatgcctccagccagctgttc
catgtccgggcccgggaagggtcctttgaagccagataccagcagccatttgaagacttc
cgcatctcgcaggagcatctcgcagaccattttgacagtcgggaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system