KEGG   Rattus norvegicus (rat): 291863Help
Entry
291863            CDS       T01003                                 

Definition
carboxylesterase-like (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    291863
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     291863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
19p12
AA seq 565 aa AA seqDB search
MRLYPLVWLFLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFAQPVAVFLGIPFAKSPL
GSLRFAPPQPAESWNFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLN
VYTPADLTKNSRLPVMVWIHGGGLVVGGSSTYDGQALSAHENVVVVTIQYRLGIWGFFST
GDEHSQGNWGHLDQLAALHWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLF
HRAISESGVSLNTALITTDSKPIANLIATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLFGNPKESYPFLPTVIDGVVLSKTPEEILAEKSFNTVPYIVGINKQEFGWIIPM
LMGYPLSEGKLDQKTANSLLWKSYPTLKISEKMIPMASEKYLGGTDDPAERKDLFKDLVA
DVIFGVPSVMVSRSHRDAGAPTFMYEFEYRPSFVSAMRPKTVIGDHGDEIFSVFGSPFLK
DGASEEETNLSKMVMKYWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDK
EVAFWSELKAKEAAEEPSHWKHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctaccctctggtctggctttttcttgctgcgtgcacagcttgggggtatcca
tcctcaccacctgtggtgaacactgttaaaggcaaagtcctggggaagtatgtcaatttg
gaaggatttgcacagcctgtggctgttttcctgggaatccccttcgccaagtcccctctt
ggctccttgaggtttgctccaccacagcctgcagagtcttggaactttgtgaagaatact
acctcctacccacctatgtgctctcaagatgctgttggagggcaggttctctcagagctt
ttcaccaacaggaaggaaaacattcctttacagttttctgaagactgcctctacctgaat
gtttatactcccgctgacttgacaaagaacagccggttaccagtgatggtgtggatccat
ggaggtggactggtagtgggtggatcatccacctatgatggacaggccctctctgcccat
gaaaatgtggtggtggtgaccattcagtatcgccttggcatctggggattcttcagcaca
ggggatgaacacagccagggcaactggggtcatttggaccagctggctgcactgcactgg
gtccaggacaatattgccaactttgggggcaacccaggctctgtgaccatctttggagaa
tctgcaggaggtttcagtgtctctgttcttgtgttatctcctctggccaagaacctcttc
cacagggccatttctgagagtggtgtgtccctcaatactgctctgattacaacagatagc
aagcccattgctaatctgattgctactctttctgggtgtaaaaccaccacatcagctgtt
atggttcattgcctgcgccagaagacagaggatgaactcctggagacttcattaaaattg
aatctttttaaactggacctatttggaaacccaaaagagagctatcccttcctacctact
gtgattgatggagtggtgctgtcaaagacaccagaagagatcctggctgagaagagtttc
aacacggtcccctacatagtgggcatcaacaagcaagagtttggctggatcattccaatg
cttatgggctatccactctccgaaggcaaactggaccagaaaacagccaattccctcttg
tggaagtcctacccaacactgaaaatctctgagaaaatgattccaatggcttctgagaag
tatttaggagggacagatgaccctgccgaaaggaaagacctgttcaaggacttggttgca
gatgtgatatttggtgtcccatcagtgatggtgtctcgaagtcacagagatgctggagcc
cccaccttcatgtatgaatttgagtatcgcccaagctttgtatcagccatgaggcccaag
acagtgatcggagaccatggtgatgaaatcttctcagtatttggatctccatttttaaaa
gatggcgcctcagaagaggagaccaatctcagcaaaatggtgatgaaatactgggccaac
tttgctcggaatgggaaccctaatgggggagggctgccccattggccagaatatgaccag
aaggaagggtacctgaagattggtgcctcaactcaggcagcccagaggctgaaggacaaa
gaagtggctttttggtctgagctcaaggccaaggaggcagcagaggaaccatcccactgg
aaacatgttgagctctga

DBGET integrated database retrieval system