KEGG   Rattus norvegicus (rat): 29322Help
Entry
29322             CDS       T01003                                 

Gene name
Plcb3
Definition
phospholipase C, beta 3 (phosphatidylinositol-specific) (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    29322 (Plcb3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    29322 (Plcb3)
   04310 Wnt signaling pathway
    29322 (Plcb3)
   04020 Calcium signaling pathway
    29322 (Plcb3)
   04070 Phosphatidylinositol signaling system
    29322 (Plcb3)
   04022 cGMP - PKG signaling pathway
    29322 (Plcb3)
 Cellular Processes
  Cell communication
   04540 Gap junction
    29322 (Plcb3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    29322 (Plcb3)
   04062 Chemokine signaling pathway
    29322 (Plcb3)
  Endocrine system
   04911 Insulin secretion
    29322 (Plcb3)
   04912 GnRH signaling pathway
    29322 (Plcb3)
   04915 Estrogen signaling pathway
    29322 (Plcb3)
   04921 Oxytocin signaling pathway
    29322 (Plcb3)
   04918 Thyroid hormone synthesis
    29322 (Plcb3)
   04919 Thyroid hormone signaling pathway
    29322 (Plcb3)
   04916 Melanogenesis
    29322 (Plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29322 (Plcb3)
   04270 Vascular smooth muscle contraction
    29322 (Plcb3)
  Digestive system
   04970 Salivary secretion
    29322 (Plcb3)
   04971 Gastric acid secretion
    29322 (Plcb3)
   04972 Pancreatic secretion
    29322 (Plcb3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29322 (Plcb3)
  Nervous system
   04724 Glutamatergic synapse
    29322 (Plcb3)
   04725 Cholinergic synapse
    29322 (Plcb3)
   04728 Dopaminergic synapse
    29322 (Plcb3)
   04726 Serotonergic synapse
    29322 (Plcb3)
   04720 Long-term potentiation
    29322 (Plcb3)
   04730 Long-term depression
    29322 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    29322 (Plcb3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29322 (Plcb3)
  Environmental adaptation
   04713 Circadian entrainment
    29322 (Plcb3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29322 (Plcb3)
   05016 Huntington's disease
    29322 (Plcb3)
  Infectious diseases
   05146 Amoebiasis
    29322 (Plcb3)
   05142 Chagas disease (American trypanosomiasis)
    29322 (Plcb3)
   05143 African trypanosomiasis
    29322 (Plcb3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     29322 (Plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 1236 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGEALLIDPLDKYPLSAGTPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKTSLEPQKSLGE
EGLNRGPNVLMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGRFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTEMCQETPSQQ
QGSQLSSNPAPNPLDASPRWPPGPTTSPTSTSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSSSALSRATNVE
DVKEEEKEAARQYREFQNRQVQSLLELREAQADAETERRLEHLKQAQQRLREVVLDAHTT
QFKRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRR
LEEAQKQRHERLLAGQQQVLQQLVEEEPKLVAQLTQECQEQRERLPQEIRRCLLGETSEG
LGDGPLVACASNGHAAGSGGHQSGADSESQEENTQL
NT seq 3711 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaaattcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgagtggaccccaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccccaagattcgagaggtactgggctttgggggtcctgacacccggctggag
gagaaactgatgacagtggtagcaggaccagatccagtaaacaccacattcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaagctggctatg
aacatactggctcagaacgcctcccggaacacgttccttcggaaagcatacacgaaactg
aagctgcaggtgaaccaggatggacggattccagtcaagaacattctgaagatgttctcc
gcggacaagaagcgggtggagactgcactggagtcctgcggcctcaacttcaaccggagt
gagtccattcggcctgatgagttttccttggaaatcttcgagcggttcttgaataagctg
tgtctgcgaccggatattgacaagatcctgctggagataggtgctaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcaaagagacccaagactcaac
gaggtgctgtacccaccgcttcgctcctcacaggctcggctgctcattgagaagtatgag
ccgaacaaacagttcctggagcgcgaccagatgtctatggagggtttcagccgctatctg
ggaggggaggagaatggcatcctgcccctggaggccctggatctgagcatggacatgacg
cagccactgagcgcatacttcatcaattcttcacacaatacctatctcactgcgggccag
ctggctggaacatcgtcagtggagatgtaccgccaggcgctgctgtggggctgccgttgt
gtggagctggatgtatggaagggacggccaccggaggaagagcccttcattacccatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgttagaggccatcgccgagacagcc
ttcaagacctcaccctaccctgtcattctctccttcgaaaaccatgtggactcggcaaaa
cagcaggccaagatggcagagtactgccgctctatctttggggaagcgctgctcattgac
ccactggacaagtacccgctgtctgcgggcaccccccttcctagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcggcatcggcccagcacaggtgtccctgacagc
tccgtgcgcaagcggcctctggaacagagcaattcagccctgagtgagagctcagctgcc
acagagccctcctcaccccagctggggtcccccagctctgacagctgccctggcctaagc
aatggggaagaggtgggacttgagaagaccagcctggagcctcagaagtctctaggtgag
gagggcctcaaccgaggacctaatgttctcatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaggaggaaacaacggatccaaaaaagcccaccaccgatgagggcaca
gccagcagtgaggtcaacgccacagaggagatgtcgacactcgtcaattacgttgagccc
gtcaagttcaagtcctttgaggctgctcgaaaaaggaacaagtgctttgagatgtcgtcc
tttgtggagaccaaggcgatggagcagctgaccaagagccccatggagttcgtggaatac
aacaaacagcagcttagtcgcatctaccccaagggcacccgtgtggactcctccaactac
atgcctcagctcttctggaacgtgggctgtcagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaacgggcgcagtgggtacttg
ctcaagcctgagtttatgcggcggccggacaagtcttttgaccccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagtttctgtct
gacaggaaggtgggcatctatgtcgaggtggacatgtttggtctcccagttgacacaaga
cgcaaatatcgcacacggacatcccaggggaactcattcaaccctgtgtgggatgaagaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcacttcgcattgcagccttt
gaggagggtggcagatttgttgggcatcgtatcctgcctgtctctgctatccgctcagga
taccactacgtctgcctgcgaaatgaggccaaccaaccgttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
atcaaccccatcaagcacgtcagcctaatggaccagcgggccaagcaactggctgctctc
attggggagagtgaggctcaggccagtacagaaatgtgtcaggagaccccgtctcaacag
caaggctcacagctctcctccaaccccgcacctaacccactggatgcctcacctcgatgg
cccccaggtcctaccacctcccccactagcacctccctcagtagcccagggcagcgagat
gatctgatcgccagcatcctttctgaggtgaccccaacacccctagaggagctccgaagc
cacaaggctatggtgaagctccggagccggcaggatcgagacctgagggaactgcataaa
aaacaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcctccagcgccctgagcagggccaccaatgtggaa
gacgtgaaggaggaagaaaaagaggcagccagacagtatcgagagttccagaaccgacaa
gtacagagcctgctggagctgagggaggcccaggcagatgcagagacagaacggaggctg
gagcatctgaaacaggctcagcagcggctcagggaggttgtcctggacgcacatacgact
cagttcaagaggctgaaggagttgaatgaaagggagaagaaggagcttcagaagatcctg
gacaggaagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggag
gtggaactgacagagatcaatcggaggcacatcactgagtcagtgaactccatcaggagg
ctggaagaggcccagaagcagcgccacgaacgcctcttggcagggcaacagcaggtcctc
cagcagctagtggaagaggagcccaagctggtggcccagctgacccaggagtgtcaggaa
cagcgagagaggctgccccaggagatccgtcggtgcctgctgggcgagacatcagaggga
ttgggggatggccccctggtggcctgtgccagcaatggtcatgcagctgggagtggtggg
caccagtccggcgctgactcggagagccaggaggaaaacacccagctttga

DBGET integrated database retrieval system