KEGG   Rattus norvegicus (rat): 294230Help
Entry
294230            CDS       T01003                                 

Gene name
Mrps18b, Ptd017
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    294230 (Mrps18b)
Ribosome [BR:rno03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    294230 (Mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 HTH_21 zf-RING_10
Motif
Other DBs
NCBI-GeneID: 294230
NCBI-ProteinID: NP_997699
RGD: 1302998
Ensembl: ENSRNOG00000000804
Vega: OTTRNOG00000001536
UniProt: Q6MG10 F6Q5K7
Position
20p12
AA seq 257 aa AA seqDB search
MCDKMAASLRHTLLRLYPSLLRSSYVAQVPLQTLCTRSPPEDASSSLPVSPFENEPWKYL
DSEEYQNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRKDKVAGNPCPICRDHKLHVDFRN
VKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKAREYGLLSYYVPQVEPRDADLRT
VHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEASGPPPESMPEMP
STAPAEASTEQTGSQSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaagatggctgcctccttgcggcacacgctgctaaggctgtatccttcactc
ttacgaagttcctatgtagctcaggttcccctccagactctctgcaccagaagcccacct
gaagatgcttcatcctcacttcccgtctccccttttgagaacgaaccttggaaatacctg
gattcagaagaataccagaaccgctatggctctcgccctgtttgggctgactaccgccgc
aaccacaaaggtggtgtgccaccacagcggacccgaaagacatgcattcgtaaggataaa
gtggctgggaatccttgccccatctgccgggatcacaagttgcatgttgactttaggaat
gtgaaactcttggaacagtttgtttgtgcccacacgggtatcatcttccatgccccatat
acaggggtctgtatgaagcagcacaagaagctgacccaggccatccagaaagccagggag
tatggtcttctcagttactacgttccccaggttgagccccgagatgctgaccttcgcact
gtacatggagctgtcagtgtgactccaccagcccccacgttgttgtcgggtgaaccttgg
tacccgtggtacagctggcaacagccaccagagagagagctctctcgccttcgccggctc
tatcaaggaaatctcctggaagcaagtggccccccacctgagtcaatgcctgagatgccc
tctacagcaccagcagaagcctccactgagcagaccggatcccagagtgcttag

DBGET integrated database retrieval system