KEGG   Rattus norvegicus (rat): 294230Help
Entry
294230            CDS       T01003                                 

Gene name
Mrps18b, Ptd017
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
rno  Rattus norvegicus (rat)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    294230 (Mrps18b)
Ribosome [BR:rno03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    294230 (Mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
20p12
AA seq 257 aa AA seqDB search
MCDKMAASLRHTLLRLYPSLLRSSYVAQVPLQTLCTRSPPEDASSSLPVSPFENEPWKYL
DSEEYQNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRKDKVAGNPCPICRDHKLHVDFRN
VKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKAREYGLLSYYVPQVEPRDADLRT
VHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEASGPPPESMPEMP
STAPAEASTEQTGSQSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaagatggctgcctccttgcggcacacgctgctaaggctgtatccttcactc
ttacgaagttcctatgtagctcaggttcccctccagactctctgcaccagaagcccacct
gaagatgcttcatcctcacttcccgtctccccttttgagaacgaaccttggaaatacctg
gattcagaagaataccagaaccgctatggctctcgccctgtttgggctgactaccgccgc
aaccacaaaggtggtgtgccaccacagcggacccgaaagacatgcattcgtaaggataaa
gtggctgggaatccttgccccatctgccgggatcacaagttgcatgttgactttaggaat
gtgaaactcttggaacagtttgtttgtgcccacacgggtatcatcttccatgccccatat
acaggggtctgtatgaagcagcacaagaagctgacccaggccatccagaaagccagggag
tatggtcttctcagttactacgttccccaggttgagccccgagatgctgaccttcgcact
gtacatggagctgtcagtgtgactccaccagcccccacgttgttgtcgggtgaaccttgg
tacccgtggtacagctggcaacagccaccagagagagagctctctcgccttcgccggctc
tatcaaggaaatctcctggaagcaagtggccccccacctgagtcaatgcctgagatgccc
tctacagcaccagcagaagcctccactgagcagaccggatcccagagtgcttag

DBGET integrated database retrieval system