KEGG   Rattus norvegicus (rat): 29520Help
Entry
29520             CDS       T01003                                 

Gene name
Padi3, Pdi3
Definition
peptidyl arginine deiminase, type III (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     29520 (Padi3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 664 aa AA seqDB search
MSLQRTVRVSLEHPTSAVCVAGVETIVDIYGSVPEGTDMFEVYGTPGVDIYVSPSMERNR
ERADTRRWCFNKGLEIIVVMNSPSNDLNDSHVQIAYHSSHEHLPLAYAVLYLTCVDITLD
CDMNCADRQDRSFVDKRQWMWGPDGYGAILLVNCDRDEVSSDAQDNCDQCVRCLQDLEDM
SVMVLRTQGPESLFDDHRLILHTSSCDAERARVFHVCGPEDSCEAYRCVLGPDRMSYEVP
RLKGYEERFYVEGLSFPDAGFPGILSFHITLLDDSNEDYSETPIFTDTVVFRVAPWIMTP
STLPPLEVYVCQVRNNTCFVEAVEELARKAGCKLTICPQAENRNDRWIQDEMELGYTQAP
HKTLPVVFDSPRNGELQGFPYKRILGLDFGYVTREPPDSSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSRGRRVTQVVRDFLHAQKVQPLVELFVDWLAVGHVDEFLSFVPA
PDGKGFRLLLASPGACFRLFQEKQKWGHGRSLLFEGVIGDRRVQTISINQVLSNQSLINF
NKFAQSCIDWNREVLKRELGLGESDIIDIPQLFKSEKRKAVAFFPDLVNMLVLGKHLGIP
KPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVRREPFAFKWW
HMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcagaggactgtacgtgtatccctggaacacccaaccagcgctgtgtgtgtg
gcaggggttgagaccatcgtggacatttatgggtcggttcctgagggcacagacatgttt
gaggtctatgggacaccgggagtggacatctacgtgtctcccagcatggagaggaaccga
gagcgagctgacaccaggcggtggtgcttcaacaaggggctggagatcatcgtggtcatg
aactctcctagcaatgacctcaacgacagtcacgttcaaatagcttaccactccagtcac
gagcatttgcccctggcctatgcagtactctacctcacctgtgtggacatcaccctggac
tgtgacatgaactgtgctgaccggcaggacaggagcttcgtggataagaggcagtggatg
tggggacctgatgggtacggagccatcttgctggtgaactgtgatcgggacgaggtcagc
tctgatgcccaagataactgtgaccaatgtgtgcgctgcctgcaagatctggaagacatg
tccgtcatggtcctacggacccagggccccgaatctctctttgacgaccacaggcttatc
ctccacacctccagctgtgatgcggagcgggcacgggtcttccacgtctgtggccccgag
gattcctgcgaagcctataggtgtgttctgggcccggaccggatgtcctatgaggtaccc
cgcctgaagggctatgaggagcgcttctacgtggagggcctctccttccctgatgcaggc
ttcccagggatcctctccttccatatcaccctgctggatgactccaatgaggactactcc
gagaccccgatcttcacggacacagtggtgttccgagtggcaccctggatcatgacgccc
agcaccctgccacccctggaggtgtacgtgtgccaggtgaggaataacacctgctttgtg
gaagctgtggaggagctggccaggaaggcaggctgcaaactcaccatctgtcctcaggca
gagaaccgcaatgaccgatggatccaggatgagatggagctggggtacacgcaggcgcca
cacaagactttgcctgtggtctttgattctccgaggaatggggagctgcagggtttccct
tacaaaaggatcctgggtctagattttggctacgtgactcgagaacctccagacagttct
gtgagcggtctggactcctttggcaacctggaggtcagcccgcccgtggtggccaatggg
aaggagtatccactggggaggattctcatcgggggcaacctgcctgggtcgagaggccgc
agagttacccaggtggtacgagacttcctccatgcccagaaggtgcaacctctggtggag
ttgtttgtggactggctggctgtgggccacgtggatgaatttctgagcttcgtccctgca
ccagatggaaagggcttccggctcctcctggccagccctggtgcctgcttcaggctattc
caggaaaagcagaagtggggccatggccggtccctccttttcgagggggtcattggtgac
aggcgggtccagaccatctccatcaatcaggttctttccaaccagagccttatcaacttt
aataagtttgcacagagctgtattgactggaaccgtgaggtgctgaagcgggagctaggc
ctgggggagagcgacatcattgacatcccacagctcttcaagtcggagaagaggaaggcg
gtggcgttcttcccggacctggtgaacatgctggtactgggcaagcacctgggcatccct
aagcccttcgggcccatcatcaatggccgctgctgcctggaggagaaggtgcgctccctg
ctggagccgctgggtctgcactgcaccttcattgatgacttcacaccgtaccacatgctg
cacggggaggttcactgtggcaccaacgtgcgccgggagccctttgccttcaagtggtgg
cacatggtgccctga

DBGET integrated database retrieval system