KEGG   Rattus norvegicus (rat): 306969Help
Entry
306969            CDS       T01003                                 

Gene name
Hist1h2bf, Hist1h2bp
Definition
histone cluster 1, H2bf
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    306969 (Hist1h2bf)
  Immune diseases
   05322 Systemic lupus erythematosus
    306969 (Hist1h2bf)
  Substance dependence
   05034 Alcoholism
    306969 (Hist1h2bf)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   306969 (Hist1h2bf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
17q11
AA seq 126 aa AA seqDB search
MPETAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaactgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtaacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgcttaagcaagtgcatccggacacgggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggctcattacaacaagcgctcgaccatcacgtcccgggagatccagacggcggtgcgc
ctgctgcttcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system