KEGG   Rattus norvegicus (rat): 312688Help
Entry
312688            CDS       T01003                                 

Gene name
Usp18
Definition
ubiquitin specific peptidase 18 (EC:3.1.2.-)
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     312688 (Usp18)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   312688 (Usp18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q42
AA seq 362 aa AA seqDB search
MGKGFGLLRKTCQSVVANPQQHSALEEEKNMKRKRVLSRELCSAWDRPHGFVGLHNIGQT
CCLNSLIQVFMMNVDFRMVLKRITVPRGAEEQKRSVPFQLLLLLEKMQDSRQKAVLPTEL
VQCLQKYNVPLFVQHDAAHLFLTIWNLTKDQITDIDLAERLQDLFTIWTEESLMCVGCGA
ESSRRGKLLTLSLPLFDMDSKPLKTLEDALRCFFQPKELASSDKCFCETCGKKTPCKQAQ
KLTGFPQTLTIHLMRFSVRNSQTVKICHSVYFPQSLDFSQILPTTDQSEIHYELFAVIAH
VGMADFGHYCAYIRNPVDGEWFCFNDSHVCWVTWKDVQCTYGDHIYRWRETAYLLVYMKT
GS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagggtttgggctcctgaggaaaacctgccagtcagttgtggctaatcctcag
cagcactcagctctggaggaagagaagaacatgaagaggaagagagtgctgtctagagag
ctctgcagtgcctgggaccgccctcatggtttcgttgggttacacaacatcggtcagaca
tgttgccttaactccttgattcaggtgttcatgatgaatgtggacttcaggatggtattg
aagaggataacagtgccacgaggggcagaagaacagaagagaagtgtccccttccagctg
cttttgctgctggagaagatgcaggacagccggcagaaggcagtgctgcccacggagctc
gttcagtgcctccagaaatacaacgtgccattgtttgtccagcacgatgctgctcatctc
ttccttacaatctggaacctgactaaggaccagatcacggacatagacttggcagagcgg
ctgcaggatctgttcacaatctggaccgaggagtccctgatgtgcgtgggctgtggagca
gagagcagcaggaggggcaagttgctcactctctctcttcctctttttgatatggattca
aagcccctaaaaacactggaggatgccttgagatgtttcttccagcccaaagagttagca
agctcagacaagtgcttctgtgagacctgcgggaagaagacgccttgcaaacaggctcag
aagctgactggtttccctcagaccctgaccatccacctcatgagattctctgtcaggaac
tcacagacagtaaagatctgccactcagtgtacttcccgcagagcttggatttcagtcag
attctgccaaccacggatcagtctgagatacactatgaactctttgctgtgattgcccat
gttgggatggcagacttcggtcattactgtgcctacatccggaatcccgtggatggagaa
tggttctgcttcaatgattcacatgtttgttgggtgacctggaaggatgtccagtgtacc
tatggggatcacatatatcgttggagggaaactgcctatctcttggtttacatgaagact
ggatcctga

DBGET integrated database retrieval system