KEGG   Rattus norvegicus (rat): 312937Help
Entry
312937            CDS       T01003                                 

Gene name
Cyld, LRRGT00003, Rp1, Rp1h
Definition
cylindromatosis (turban tumor syndrome) (EC:3.4.19.12)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    312937 (Cyld)
  Development
   04380 Osteoclast differentiation
    312937 (Cyld)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     312937 (Cyld)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C67
   312937 (Cyld)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19p11
AA seq 953 aa AA seqDB search
MSSGLWNQEKVTSPYWEERLFYLLLQECSVTDKQTQKLLRVPKGSIGQYIQDRSVGHSRV
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERLSLFRNRIRLS
KGLQVDVGSPVRVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDNGLESDFAGPGDTVQVEPPPLEINSRVSLKV
GESTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTVLLHIN
DIIPDSVTQERRPPKLAFMSRGVGDKGSSSHNKPKVTGSTSDPGSRNRSELFYTLNGSSV
DSQQQSKSKNPWYIDEVAEDPAKSLTEMSSDFGHSSPPPQPPSMNSLSSENRFHSLPFSL
TKMPNTNGSMAHSPLSLSVQSVMGELNSTPVQESPPMPSSSGNAHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLSDVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSALDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNE
KVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLED
TPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHTYHPVSLPKD
LPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNI
PQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcctgtggaaccaagagaaagttacttcaccctactgggaagaacggctt
ttttatctgcttcttcaagaatgcagtgtaacagacaaacagacacagaagctcctgaga
gtacccaaagggagcataggacagtacatccaagaccgttccgtggggcattcaagagtt
ccttctgctaaaggcaagaaaaatcagattggattaaaaatcttagagcaaccgcatgca
gttctgtttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttactg
ttggcaattaccaactgtgaggagaggctcagcctatttagaaacagaatccgactaagt
aaaggcctccaggtagacgtgggcagtcctgtgagagtacagctgcgatctggggaggag
aagtttccaggagttgtacgcttcagaggacctttattagcggagaggacggtgtcgggg
attttctttggagtagaattactggaagaaggtcgtggccaaggtttcactgatggggtg
tatcaaggaaaacagctcttccagtgtgatgaggactgtggcgtttttgttgcattggac
aagctggagcttatagaagatgatgacaatgggttggaaagtgattttgcaggcccagga
gatacagtccaggttgaacctccccctttggaaataaactccagagtttctttgaaggtt
ggagaaagtacagaatctggaacagtgatattctgtgatgttttaccaggaaaagagagt
ctaggatattttgttggtgtggacatggataaccctattggcaactgggacggaaggttt
gatggggttcagctttgcagttttgcaagtgttgagagtacagttctcctacacatcaat
gacatcatcccagatagcgtgacacaggaaaggagacctcccaaacttgcctttatgtca
agaggtgtaggtgacaaaggttcatctagtcataataaaccaaaggttacaggatctacc
tcagaccctggaagtagaaacagatctgaattattttataccttaaatgggtcatctgtt
gactcacaacaacaatccaagtccaaaaacccatggtacattgatgaagttgcagaagac
cctgcaaagtcacttacagagatgtcttcagacttcggacattcatcgcctccaccgcaa
cctccttccatgaactccttgtctagcgagaacagattccactccttacccttcagcctg
acaaagatgcccaacactaatggcagcatggctcacagtccactctctctgtcagtgcag
tctgtgatgggagagctgaacagcactcctgtccaggagagtccacccatgcccagctct
tctgggaatgcacacgggctagaggtgggctcactggctgaagtaaaagagaaccccccg
ttctatggggttatccgttggattggccagccaccagggctcagtgacgtgcttgctgga
ttggaactggaagatgaatgcgcaggttgtacggatggaactttcaggggcacgcgctat
ttcacctgtgccctgaagaaagcactgttcgtgaaactgaagagctgcagaccagactct
aggtttgcatccttgcagcctgtttccaatcagatcgaaaggtgtaactctttagcattt
gggggctacttaagtgaagtagtagaagaaaatacgccacctaaaatggaaaaggaaggt
ttagagataatgattggaaagaagaaaggcatccagggccattacaattcttgttactta
gactcaactttattctgcttatttgcttttagttctgccctggacactgtattacttaga
cccaaagagaagaatgatgtagagtattacagtgagactcaagagctactgaggacagag
atagtcaatcctctgagaatatatggatatgtgtgtgccacaaagattatgaagctgagg
aaaatacttgaaaaagttgaggctgcatcaggatttacctctgaggaaaaagatcctgaa
gaatttctaaacatcctgtttcatgatattttaagggttgaaccattgttaaaaataagg
tcagcaggtcaaaaagttcaagactgtaacttctatcaaatttttatggaaaaaaatgag
aaagtcggagtacccacaatccagcagttattagaatggtcttttatcaacagcaacctg
aaatttgcagaggcaccatcatgcttgattatccagatgcctcggtttgggaaagacttt
aaactatttaaaaaaatttttccttccctggaattaaatataacagatttacttgaagac
actcccaggcagtgccgcatctgtggaggactcgccatgtatgagtgtagagagtgctat
gatgacccggacatctcggcagggaagatcaagcagttctgtaagacctgcagcactcag
gttcaccttcatcccagaagactgaatcacacttaccatccagtatcacttcccaaagac
ttgcccgactgggactggagacacggctgcatcccgtgtcagaagatggagttatttgct
gtgctctgcatagaaaccagccactatgttgcttttgtgaagtacgggaaggatgactct
gcctggctcttctttgacagcatggctgatcgagatggtggtcagaatggcttcaacatt
ccacaagtgacaccctgcccagaagtaggagagtacttgaagatgtctctggaggacctg
cactctttggactccagaaggattcaaggctgtgcgcgcagacttctttgcgatgcatac
atgtgcatgtaccagagtccaaccatgagcttgtacaaataa

DBGET integrated database retrieval system