KEGG   Rattus norvegicus (rat): 313929Help
Entry
313929            CDS       T01003                                 

Gene name
Ncoa1, SRC-1
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    313929 (Ncoa1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     313929 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q14
AA seq 1417 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLGTE
NQEACQRYEVMQCFTVSQPKSIQEDGEGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIH
IIDREHSGLSPQDDTNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARANRQQ
STDLNSGSSHSNSSSSQGSFGCSPGNQIVASVALSQGQAGSQSSNPSLNLNNSPMEGTGI
SLAQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACSNNNRSYSNIPVTSL
QGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDNKEIASILNEMIQSDNS
ANEGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCT
GTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSASASTAM
SVSGQAQGSASIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPAPVTKPAPEEVKLESQSQFSADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VPGVNIKSEILPASLQPTPARSAPRLNRLPELELEAIDNQFGQPGAGDQIPWANNTVTAI
NQSKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEDRPTLYPQPYSSPSPTAGLSGPFQGMVRQKPSLG
TMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQ
FAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQS
FGNNIPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLA
TRSSMVNRGMAGNMGGQFGTGISPQMQQNVFQYPGSGLVPQAEANFAPSLSPGSSMVPMP
IPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVS
MAGGNANVQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTE
ADGNQDKKTEEFFSVQVQQLQVFADVQCTVNLKGASKPTLVLAVLLQEKAIRTNADEEHG
LKTSRKKPFPQVLPSASHRPWYKQLHKNSIYSETTGL
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatccgaccctgcgaacccagactcacataagagaaaa
ggatcgccatgtgacacactggcatcaagtactgagaagaggcgcagggagcaagaaaat
aagtatttagaagaactagctgaattactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagatcttgaagaagacagtagatcagatacagctaatg
aagagaatggagcaagagaaatccacaactgatgatgacgtgcagaagtccgacatctca
tcgagcagtcaaggagtgatagagaaggagtcgctgggcccccttcttctggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtgtcagaaaatgtg
accagctacctgggttacaatcaggaagaattaatgaataccagcgtctacagcatactg
catgtgggagatcatgcagaatttgtcaagaatctactaccaaaatcactaggcactgag
aaccaagaagcttgccagcgctatgaagtaatgcagtgtttcacggtgtcacagccaaaa
tcaatccaagaagatggcgaaggcaaaatcatctctattgacactagctccctgagagct
gctggcaggactggctgggaagatttagtaaggaaatgtatctatgcttttttccaacct
cagggcagagagccatcttatgcccgacagctgtttcaagaagtgatgactcgtggcact
gcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcccacacc
aagtgtaaactttgctaccctcaaagtcctgacatgcagcctttcatcatgggaattcat
atcatcgacagggagcacagtgggctttctcctcaagatgacactaattctggaatgtca
attccccgaataaacccctcagtcaatcctggtatctctccagcccatggtgtgacccgt
tcatccacgttgccaccatccaacaacaacatggtctctgccagagcaaaccgccagcag
agcacagaccttaacagcggcagcagtcacagtaactctagcagcagccaagggagcttt
ggatgctcacctggaaatcagattgtagccagcgttgccttaagccagggacaggcaggt
tcccagagcagtaatccgtctttaaacctcaataattctcctatggaaggtacaggaatt
tccctcgcacagttcatgtctccgaggagacaagctaattctggcttggcaacaagggcc
aggatgtcaaacaattcatttcctccaaatattccaacattaagctccccggttggcatc
actagcggtgcctgtagtaataataaccgatcctattccaatatcccagtaacatcttta
caaggtatgaatgaaggacccaataattctgttggcttctctgccggctctccagtcctt
cggcagatgagctcacagaattcacctagcagattaagtatgcaaccagcaaaagccgag
tccaaagacaacaaagagattgcatccattttaaatgaaatgattcagtcagacaacagt
gctaacgaaggcaagcctctggactcaggacttctgcataacaatgacagactctcagat
ggagacagtaagtactctcaaactagtcacaaactagtacagctattgacgactaccgca
gagcagcagttacggcatgctgacatagacacgagctgcaaagacgtcctgtcctgcact
ggcacttccagctccgcctcctctaacccctcaggaggtacttgtccctcttcccacagc
tctctgactgagcggcataaaattctgcatcggcttttacaggagggcagcccctcagac
atcaccaccttgtctgtggaacccgaaaagaaggacagtgcgtcagcttctactgctatg
tcagtgtctggacaagcccaggggagtgccagcataaaactagaactggatgcttcaaag
aaaaaagagtcaaaagaccatcagctcctacgctaccttttagacaaagatgagaaagat
ttaagatcaactccaaacctgagcctggatgacgtaaaggtcaaagtggagaagaaagag
cagatggatccttgtaacacaaacccagccccagtgaccaaacctgctcccgaggaggtt
aaactcgagtcccagagccagttttcagctgaccttgaccagtttgatcagttattgccc
acactggagaaggcagcgcagttgccgggcttgtgtgagacagacagaatggatggtgcg
gtccccggtgtgaacatcaagtcggagatcctgcccgcttcacttcagcccacccctgcc
agatctgctcccaggctgaacagattgcctgaactagaattagaagcaatcgataaccag
tttggacaaccaggagcaggggatcagattccatgggcaaataatactgtgacggcgata
aatcagagtaaaccagaagaccaatgtattagctcacagttggatgagctcctctgtcca
ccaacaacagtagaaggaagaaatgatgagaaggcccttctggaacaactggtgtctttc
ctcagtggcaaagatgagacggagctggccgagctagacagagcgctggggattgacaaa
cttgtacagggaggtggattagatgtattatctgagagatttccaccacagcaagcaaca
ccacctttgatgatggaagacaggcccaccctctatccccagccatactcgtctccttct
cccaccgccggtctctctggccctttccaaggcatggtccgacagaagccttcactgggt
actatgccggttcaagtaacacctcctcgaggaaccttttcacccaacatgggcatgcaa
ccccggcagactctaaatagacctccagctgcacccaaccagcttcggctgcagctgcag
cagcggctacaggggcagcagcagttgatgcaccaaaaccggcaagctatcttgaaccag
tttgcagcaaatgctcctgttggcatgaacatgaggtcaggcatgcagcagcagataaca
cctcagccacccctgaatgctcagatgttggcacagcgccaacgggagctgtacagtcag
cagcatcgacagaggcaaattatccagcagcaaagagccatgctcatgaggcaccaaagc
tttgggaacaacatccctccttcatccggactcccagttcaaatggggaacccccgtctt
cctcagggtgctccacagcagttcccctacccaccaaactatggtacaaatccaggaacc
ccacctgcttctaccagccctttctctcaactggcagcaaaccctgaggcatccttggcc
acccgcagcagcatggtgaacagaggcatggcagggaacatgggaggacagtttggtact
ggcatcagtccgcagatgcagcagaatgtcttccagtacccagggtcaggactggttccc
caagctgaggccaactttgccccatctctaagccctgggagctccatggtgccgatgcca
atccctcctcaaagctctctgctccaacaaactccacccacttctgggtaccagtcaccg
gacatgaaggcctggcagcaaggaacaatgggaaacaacaatgtgttcagtcaagccgtc
cagagccagcctgcccctgcacagccaggagtgtacaacaacatgagcatcaccgtgtcc
atggcaggtggaaacgcaaacgttcagaacatgaatccaatgatgggccagatgcaaatg
agctctctgcagatgccagggatgaacactgtgtgctctgagcagatgaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaaccgaa
gcagatggaaaccaggacaagaagacagaagagttcttctctgtgcaggtgcagcagctt
caggtgtttgctgacgtccagtgtacagtgaacctgaaaggagccagcaaaccgactcta
gtgctagcagttctgctacaagaaaaggccataagaaccaatgcagatgaggagcatgga
ctcaagacttcaaggaagaagccatttccccaggtccttccttctgcatctcaccgcccc
tggtacaaacaactccataagaacagcatctactcagaaactacaggactttga

DBGET integrated database retrieval system