KEGG   Rattus norvegicus (rat): 313929Help
Entry
313929            CDS       T01003                                 

Gene name
Ncoa1, SRC-1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04915  Estrogen signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05200  Pathways in cancer
rno05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    313929 (Ncoa1)
   04919 Thyroid hormone signaling pathway
    313929 (Ncoa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    313929 (Ncoa1)
   05224 Breast cancer
    313929 (Ncoa1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     313929 (Ncoa1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    313929 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 313929
NCBI-ProteinID: NP_001101482
RGD: 1309046
Ensembl: ENSRNOG00000004068
UniProt: D4A3Q3
Position
6q14
AA seq 1417 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLGTE
NQEACQRYEVMQCFTVSQPKSIQEDGEGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQP
QGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIH
IIDREHSGLSPQDDTNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARANRQQ
STDLNSGSSHSNSSSSQGSFGCSPGNQIVASVALSQGQAGSQSSNPSLNLNNSPMEGTGI
SLAQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACSNNNRSYSNIPVTSL
QGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDNKEIASILNEMIQSDNS
ANEGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCT
GTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSASASTAM
SVSGQAQGSASIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPAPVTKPAPEEVKLESQSQFSADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VPGVNIKSEILPASLQPTPARSAPRLNRLPELELEAIDNQFGQPGAGDQIPWANNTVTAI
NQSKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEDRPTLYPQPYSSPSPTAGLSGPFQGMVRQKPSLG
TMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQ
FAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQS
FGNNIPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLA
TRSSMVNRGMAGNMGGQFGTGISPQMQQNVFQYPGSGLVPQAEANFAPSLSPGSSMVPMP
IPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVS
MAGGNANVQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTE
ADGNQDKKTEEFFSVQVQQLQVFADVQCTVNLKGASKPTLVLAVLLQEKAIRTNADEEHG
LKTSRKKPFPQVLPSASHRPWYKQLHKNSIYSETTGL
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatccgaccctgcgaacccagactcacataagagaaaa
ggatcgccatgtgacacactggcatcaagtactgagaagaggcgcagggagcaagaaaat
aagtatttagaagaactagctgaattactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagatcttgaagaagacagtagatcagatacagctaatg
aagagaatggagcaagagaaatccacaactgatgatgacgtgcagaagtccgacatctca
tcgagcagtcaaggagtgatagagaaggagtcgctgggcccccttcttctggaggctttg
gatggatttttctttgttgtgaactgtgaaggaagaattgtatttgtgtcagaaaatgtg
accagctacctgggttacaatcaggaagaattaatgaataccagcgtctacagcatactg
catgtgggagatcatgcagaatttgtcaagaatctactaccaaaatcactaggcactgag
aaccaagaagcttgccagcgctatgaagtaatgcagtgtttcacggtgtcacagccaaaa
tcaatccaagaagatggcgaaggcaaaatcatctctattgacactagctccctgagagct
gctggcaggactggctgggaagatttagtaaggaaatgtatctatgcttttttccaacct
cagggcagagagccatcttatgcccgacagctgtttcaagaagtgatgactcgtggcact
gcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcccacacc
aagtgtaaactttgctaccctcaaagtcctgacatgcagcctttcatcatgggaattcat
atcatcgacagggagcacagtgggctttctcctcaagatgacactaattctggaatgtca
attccccgaataaacccctcagtcaatcctggtatctctccagcccatggtgtgacccgt
tcatccacgttgccaccatccaacaacaacatggtctctgccagagcaaaccgccagcag
agcacagaccttaacagcggcagcagtcacagtaactctagcagcagccaagggagcttt
ggatgctcacctggaaatcagattgtagccagcgttgccttaagccagggacaggcaggt
tcccagagcagtaatccgtctttaaacctcaataattctcctatggaaggtacaggaatt
tccctcgcacagttcatgtctccgaggagacaagctaattctggcttggcaacaagggcc
aggatgtcaaacaattcatttcctccaaatattccaacattaagctccccggttggcatc
actagcggtgcctgtagtaataataaccgatcctattccaatatcccagtaacatcttta
caaggtatgaatgaaggacccaataattctgttggcttctctgccggctctccagtcctt
cggcagatgagctcacagaattcacctagcagattaagtatgcaaccagcaaaagccgag
tccaaagacaacaaagagattgcatccattttaaatgaaatgattcagtcagacaacagt
gctaacgaaggcaagcctctggactcaggacttctgcataacaatgacagactctcagat
ggagacagtaagtactctcaaactagtcacaaactagtacagctattgacgactaccgca
gagcagcagttacggcatgctgacatagacacgagctgcaaagacgtcctgtcctgcact
ggcacttccagctccgcctcctctaacccctcaggaggtacttgtccctcttcccacagc
tctctgactgagcggcataaaattctgcatcggcttttacaggagggcagcccctcagac
atcaccaccttgtctgtggaacccgaaaagaaggacagtgcgtcagcttctactgctatg
tcagtgtctggacaagcccaggggagtgccagcataaaactagaactggatgcttcaaag
aaaaaagagtcaaaagaccatcagctcctacgctaccttttagacaaagatgagaaagat
ttaagatcaactccaaacctgagcctggatgacgtaaaggtcaaagtggagaagaaagag
cagatggatccttgtaacacaaacccagccccagtgaccaaacctgctcccgaggaggtt
aaactcgagtcccagagccagttttcagctgaccttgaccagtttgatcagttattgccc
acactggagaaggcagcgcagttgccgggcttgtgtgagacagacagaatggatggtgcg
gtccccggtgtgaacatcaagtcggagatcctgcccgcttcacttcagcccacccctgcc
agatctgctcccaggctgaacagattgcctgaactagaattagaagcaatcgataaccag
tttggacaaccaggagcaggggatcagattccatgggcaaataatactgtgacggcgata
aatcagagtaaaccagaagaccaatgtattagctcacagttggatgagctcctctgtcca
ccaacaacagtagaaggaagaaatgatgagaaggcccttctggaacaactggtgtctttc
ctcagtggcaaagatgagacggagctggccgagctagacagagcgctggggattgacaaa
cttgtacagggaggtggattagatgtattatctgagagatttccaccacagcaagcaaca
ccacctttgatgatggaagacaggcccaccctctatccccagccatactcgtctccttct
cccaccgccggtctctctggccctttccaaggcatggtccgacagaagccttcactgggt
actatgccggttcaagtaacacctcctcgaggaaccttttcacccaacatgggcatgcaa
ccccggcagactctaaatagacctccagctgcacccaaccagcttcggctgcagctgcag
cagcggctacaggggcagcagcagttgatgcaccaaaaccggcaagctatcttgaaccag
tttgcagcaaatgctcctgttggcatgaacatgaggtcaggcatgcagcagcagataaca
cctcagccacccctgaatgctcagatgttggcacagcgccaacgggagctgtacagtcag
cagcatcgacagaggcaaattatccagcagcaaagagccatgctcatgaggcaccaaagc
tttgggaacaacatccctccttcatccggactcccagttcaaatggggaacccccgtctt
cctcagggtgctccacagcagttcccctacccaccaaactatggtacaaatccaggaacc
ccacctgcttctaccagccctttctctcaactggcagcaaaccctgaggcatccttggcc
acccgcagcagcatggtgaacagaggcatggcagggaacatgggaggacagtttggtact
ggcatcagtccgcagatgcagcagaatgtcttccagtacccagggtcaggactggttccc
caagctgaggccaactttgccccatctctaagccctgggagctccatggtgccgatgcca
atccctcctcaaagctctctgctccaacaaactccacccacttctgggtaccagtcaccg
gacatgaaggcctggcagcaaggaacaatgggaaacaacaatgtgttcagtcaagccgtc
cagagccagcctgcccctgcacagccaggagtgtacaacaacatgagcatcaccgtgtcc
atggcaggtggaaacgcaaacgttcagaacatgaatccaatgatgggccagatgcaaatg
agctctctgcagatgccagggatgaacactgtgtgctctgagcagatgaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaaccgaa
gcagatggaaaccaggacaagaagacagaagagttcttctctgtgcaggtgcagcagctt
caggtgtttgctgacgtccagtgtacagtgaacctgaaaggagccagcaaaccgactcta
gtgctagcagttctgctacaagaaaaggccataagaaccaatgcagatgaggagcatgga
ctcaagacttcaaggaagaagccatttccccaggtccttccttctgcatctcaccgcccc
tggtacaaacaactccataagaacagcatctactcagaaactacaggactttga

DBGET integrated database retrieval system