KEGG   Rattus norvegicus (rat): 363452Help
Entry
363452            CDS       T01003                                 

Gene name
Otud5
Definition
OTU domain containing 5 (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:rno04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq13
AA seq 523 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGERDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALVGG
ASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGA
CLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHI
EMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGV
GLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYL
QWLRDQEKQARQVRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELH
AELGIKPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSP
SAFGLNDWDDDEILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccacctcccgacgccgacccggccaacgaaccg
ccgccgcccgggccgctgcccccagcgcctcggcgcggtgggggtgtaggcgtgggcggc
ggcggcacgggcgtgggcggaggagagcgcgaccgtgactccggcgtcgtgggggcccgt
ccccgggcttcaccaccacctcagggaccgctaccggggccgcctggtgctcttcatcgt
tgggcactagccgtgccgcctggcgcagtcgcgggccctcggccacagcaggcttctcca
cctccttgtgggggccctggtggccccggcggcggtcccggtgacgctcttgttggcggg
gccagtccggaacgtgaagaggtcggagcaggctacaacagcgaagacgaatatgaagct
gctgcagcacgaatcgaggccatggatcccgccactgtagaacagcaggaacactggttt
gaaaaggccttgcgggacaagaaaggcttcatcatcaagcagatgaaggaggatggtgcc
tgtctattccgggctgtagctgaccaggtgtatggagaccaggacatgcatgaggttgtg
cgaaagcattgcatggactatctgatgaagaatgccgattacttttccaactatgtcaca
gaagacttcaccacctatatcaatcggaagcggaaaaacaactgccatgggaaccacatt
gagatgcaggctatggcagagatgtacaaccgtcctgtggaggtgtatcagtatagcaca
gaacctatcaacacattccatgggatccatcaaaatgaagatgaacccatccgtgtcagc
taccaccggaatatccactataattcagtggtgaatcctaacaaggccactattggtgtg
gggctgggcctgccatcatttaaaccagggtttgcagagcagtccctgatgaagaatgcc
ataaagacatcagaagagtcatggattgaacagcaaatgctggaagacaagaaacgagct
acagactgggaggccacaaatgaggccatagaggagcaggtggctcgagaatcttacctg
cagtggctgagggatcaagagaaacaggcccgccaggtccggggacccagccagccacgg
aaagccagtgccacatgcagttcagccacagcagcagcctccagtggcctggaggaatgg
actagtcggtccccacggcaacgaagttcagcctcgtcacctgagcaccctgaactgcat
gccgagctaggcattaagcccccttccccaggcactgtgttagctcttgccaaacctcct
tcaccctgtgcaccaggtacaagcagtcagttctcagcaggggctgatcgggccacctct
cctcttgtgtccctctaccctgctctggagtgccgggccctcatccagcagatgtccccc
tctgcctttggtctgaatgattgggatgatgatgagatcctagcatcggtgctggcagtg
tcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagacccaccccca
gacaagagttga

DBGET integrated database retrieval system