KEGG   Rattus norvegicus (rat): 363452Help
Entry
363452            CDS       T01003                                 

Gene name
Otud5
Definition
OTU deubiquitinase 5 (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    363452 (Otud5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     363452 (Otud5)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   363452 (Otud5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq13
AA seq 523 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGGGVGVGGGGTGVGGGERDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALVGG
ASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGA
CLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHI
EMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGV
GLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYL
QWLRDQEKQARQVRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELH
AELGIKPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSP
SAFGLNDWDDDEILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactattctccccaaaaagaagccgccacctcccgacgccgacccggccaacgaaccg
ccgccgcccgggccgctgcccccagcgcctcggcgcggtgggggtgtaggcgtgggcggc
ggcggcacgggcgtgggcggaggagagcgcgaccgtgactccggcgtcgtgggggcccgt
ccccgggcttcaccaccacctcagggaccgctaccggggccgcctggtgctcttcatcgt
tgggcactagccgtgccgcctggcgcagtcgcgggccctcggccacagcaggcttctcca
cctccttgtgggggccctggtggccccggcggcggtcccggtgacgctcttgttggcggg
gccagtccggaacgtgaagaggtcggagcaggctacaacagcgaagacgaatatgaagct
gctgcagcacgaatcgaggccatggatcccgccactgtagaacagcaggaacactggttt
gaaaaggccttgcgggacaagaaaggcttcatcatcaagcagatgaaggaggatggtgcc
tgtctattccgggctgtagctgaccaggtgtatggagaccaggacatgcatgaggttgtg
cgaaagcattgcatggactatctgatgaagaatgccgattacttttccaactatgtcaca
gaagacttcaccacctatatcaatcggaagcggaaaaacaactgccatgggaaccacatt
gagatgcaggctatggcagagatgtacaaccgtcctgtggaggtgtatcagtatagcaca
gaacctatcaacacattccatgggatccatcaaaatgaagatgaacccatccgtgtcagc
taccaccggaatatccactataattcagtggtgaatcctaacaaggccactattggtgtg
gggctgggcctgccatcatttaaaccagggtttgcagagcagtccctgatgaagaatgcc
ataaagacatcagaagagtcatggattgaacagcaaatgctggaagacaagaaacgagct
acagactgggaggccacaaatgaggccatagaggagcaggtggctcgagaatcttacctg
cagtggctgagggatcaagagaaacaggcccgccaggtccggggacccagccagccacgg
aaagccagtgccacatgcagttcagccacagcagcagcctccagtggcctggaggaatgg
actagtcggtccccacggcaacgaagttcagcctcgtcacctgagcaccctgaactgcat
gccgagctaggcattaagcccccttccccaggcactgtgttagctcttgccaaacctcct
tcaccctgtgcaccaggtacaagcagtcagttctcagcaggggctgatcgggccacctct
cctcttgtgtccctctaccctgctctggagtgccgggccctcatccagcagatgtccccc
tctgcctttggtctgaatgattgggatgatgatgagatcctagcatcggtgctggcagtg
tcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagacccaccccca
gacaagagttga

DBGET integrated database retrieval system