KEGG   Rattus norvegicus (rat): 500462Help
Entry
500462            CDS       T01003                                 

Gene name
RGD1564956
Definition
similar to calcium binding protein P22
Orthology
K17610  
calcineurin B homologous protein 1
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
5q24
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGLEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacacgcctgtacagccgcttcaccagcctggacaaa
ggggagaacggaactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttcttctcagagggagaggatcaggtaaacttc
cgaggattcatgagaactttggctcatttccgacccattgaggataacgaaaagagcaaa
gatgtgaatggactggaacccctcaacagccggagcaacaaactgcactttgctttcaga
ctttatgacttggataaagatgacaagatctcccgcgatgagctgttacaggtactgcga
atgatggtcggagtgaatatctcagatgagcagctgggcagtattgcagacaggaccatc
caggaggctgaccaagatggagacagtgccatatcttttacagaatttgttaaggttttg
gagaaggtggatgtagaacagaagatgagcatccgatttcttcactaa

DBGET integrated database retrieval system